etc
Check-in [4af6d35c0b]
Not logged in

Many hyperlinks are disabled.
Use anonymous login to enable hyperlinks.

Overview
Comment:import 2048 project Here, I will try to give it a test bed and make it enterprise-y instead of hackish
Timelines: family | ancestors | descendants | both | trunk
Files: files | file ages | folders
SHA1:4af6d35c0be26cfa106cfb8a03b4159c415d6063
User & Date: alzwded 2014-04-12 10:12:36
Context
2014-04-12
10:14
update README.md check-in: 397df2bf59 user: alzwded tags: trunk
10:12
import 2048 project Here, I will try to give it a test bed and make it enterprise-y instead of hackish check-in: 4af6d35c0b user: alzwded tags: trunk
10:05
another edit (turn autosync please...) check-in: f33d70ecb9 user: alzwded tags: trunk
Changes
Hide Diffs Unified Diffs Ignore Whitespace Patch

Added t2048/2048.cpp.



































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
#include <deque>
#include <list>
#include <cstdarg>
#include <cstdio>
#include <algorithm>
#include <set>
#include <cstring>
#include <ctime>
#include "header.h"

#define ONLY_IF_TALKING // debug stuff
static bool TALKATIVE = 0;
#define TALK if(TALKATIVE) printf

cell_t board[16] = {
    1, 0, 1, 2,
    1, 1, 1, 0,
    0, 0, 1, 0,
    2, 1, 0, 1
};

// resolves movement on cells
class Pack {
    // pointers to the actual cells that will be modified
    std::deque<cell_t*> pointers_;

    // perform actual shift removing any 0 values (empty cells)
    void shift_(std::list<cell_t>& cells, int& moved)
    {
        moved = 0;
        TALK("new shift\n");
        // copy values into results vector
        std::transform(
                pointers_.rbegin(),
                pointers_.rend(),
                std::inserter(cells, cells.begin()),
                [&](cell_t* p) { return *p; });

        ONLY_IF_TALKING for(auto i = cells.begin(); i != cells.end(); ++i) {
            TALK("%d ", *i);
        ONLY_IF_TALKING }
        TALK("\n");

        for(auto cell = cells.begin(), next = cell;
                cell != cells.end() && ++next != cells.end();
                next = cell)
        {
            TALK("I am %d\n", *cell);
            ONLY_IF_TALKING for(auto cell = cells.begin(); cell != cells.end(); ++cell) {
                TALK("%d ", *cell);
            ONLY_IF_TALKING }
            TALK("\n");
            if(!*cell) { // special case I don't know how to get rid of: 0 on edge
                TALK("removing self (0)\n");
                cells.erase(cell);
                cell = next;
                if(next != cells.end() && *next) moved = 1;
            } else if(!*next) { // eliminate empty cells
                TALK("removing buddy (0)\n");
                cells.erase(next);
                next = cell;
                next++;
                if(next != cells.end() && *next) moved = 1;
            } else if(*cell == *(next)) { // merge cells of equal value
                moved = 1;
                TALK("merging with buddy (%d)\n", *cell);
                ++*cell;
                cells.erase(next);
                ++cell;
            } else { // default, move to next cell
                TALK("moving along\n");
                ++cell;
            }
        }
    }

    struct Translator {
        std::list<cell_t> const& cells_;
        std::list<cell_t>::const_iterator i_;
        Translator(std::list<cell_t> const& cells)
            : cells_(cells)
            , i_(cells.begin())
        {}

        void operator()(cell_t* cell)
        {
            if(i_ != cells_.end()) *cell = *i_++;
            else *cell = 0;
        }
    };

public:
    typedef std::deque<cell_t*> Builder;

    Pack(cell_t* first, ...)
    {
        va_list p;
        va_start(p, first);
        for(cell_t* i = first; i; i = va_arg(p, cell_t*)) {
            TALK("pushing %d\n", *i);
            pointers_.push_back(i);
        }
        va_end(p);
    }

    Pack(Builder const& bld)
    {
        std::copy(bld.begin(), bld.end(), std::inserter(pointers_, pointers_.begin()));
    }

    // shift cells left-to-right relative to the order the cells were
    //     passed into the constructor
    int shift()
    {
        std::list<cell_t> cells;
        int anythingAccomplished = 0;
        shift_(cells, anythingAccomplished);
        std::for_each(pointers_.rbegin(), pointers_.rend(), Translator(cells));
        return anythingAccomplished;
    }
};

// a line is defined as A*i + B*j + B0, for j = 0..3 and a given i
template<int A, int B0, int B>
int tshift()
{
    int ret = 0;
    for(size_t i = 0; i < 4; ++i) {
        Pack::Builder line;
        for(size_t j = 0; j < 4; ++j) {
            line.push_back(&board[A * i + B * j + B0]);
        }
        ret = Pack(line).shift() || ret;
    }
    return ret;
}

int nop() {}

shift_fn shift[5] = {
    &nop,
    &tshift<1, 12, -4>,
    &tshift<4, 3, -1>,
    &tshift<1, 0, 4>,
    &tshift<4, 0, 1>,
};

void addRandomTile()
{
    cell_t maxi = 1;
    std::set<cell_t> cells;
    for(size_t i = 0; i < 16; cells.insert(i++));

    static auto n = time(NULL);
    n = n * 3913 + 23;

    while(cells.size()) {
        auto i = cells.begin();
        std::advance(i, n % cells.size());
        if(!board[*i]) { board[*i] = maxi; break; }
        else { maxi = std::max(maxi, (cell_t)(board[*i] / 2)); }
        cells.erase(i);
    }
}

int main(int argc, char* argv[])
{
    memset(board, 0, 16); // TODO uncomment after actual game is implemented

    addRandomTile();
    addRandomTile();

    init_display(&argc, argv);
    loop();

    return 0;
}

Added t2048/FreeMono.ttf.

cannot compute difference between binary files

Added t2048/Makefile.



























































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
all: a.out 2048-cleaned.cpp

a.out: 2048.o display.o
	g++ -g 2048.o display.o -lSDL -lSDL_ttf

2048.exe: 2048.obj display.obj 
	i686-w64-mingw32-g++ -static-libgcc -static-libstdc++ -o 2048.exe 2048.obj display.obj -Lvendor/SDL-1.2.15/bin -Lvendor/SDL_ttf-2.0.11/lib/x86 -lSDL -lSDL_ttf
	cp vendor/SDL-1.2.15/bin/SDL.dll .
	cp vendor/SDL_ttf-2.0.11/lib/x86/SDL_ttf.dll .
	cp vendor/SDL_ttf-2.0.11/lib/x86/libfreetype-6.dll .
	cp vendor/SDL_ttf-2.0.11/lib/x86/zlib1.dll .

2048.obj: 2048.cpp
	i686-w64-mingw32-g++ --std=gnu++0x -g -o 2048.obj -c 2048.cpp

display.obj: display.c
	i686-w64-mingw32-gcc --std=gnu99 -g -c -o display.obj -g --std=gnu99 -c -Ivendor/include display.c

display.o: display.c
	gcc -g --std=gnu99 -c display.c

2048.o: 2048.cpp
	g++ -g --std=gnu++11 -c 2048.cpp -o 2048.o

2048-cleaned.cpp: 2048.cpp
	sed 2048.cpp -e '/TALK/d' > 2048-cleaned.cpp

clean:
	rm -f a.out 2048-cleaned.cpp *.o 2048.exe *.obj *.dll

Added t2048/README.md.























>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
2048
====

My very own C++/C/SDL implementation of the 2048 game. TODO give credit, I forgot who did it originally.

Playing
=======

You can either experiment with building this turkey yourself, or you can grab it from the release section of this page here: https://github.com/alzwded/etc/releases/tag/jak2048v1.0

Have fun!

Added t2048/display.c.

































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
#include <SDL/SDL.h>
#include <SDL/SDL_ttf.h>
#include <stdio.h>
#include <string.h>
#include <stdlib.h>
#include "header.h"

static SDL_Surface* window;
static int looping;
static direction_t direction = NONE;
volatile int timerStopped = 0;
static TTF_Font* font;

static Uint32 getColor(cell_t c)
{
#define steps 10
#define step (256/steps)
    if(!c) return (128 << 16) | (128 << 8) | 128;
    if(c <= steps) return (255 << 16) | ( (255 - c * step) << 8 ) | 0;
    else return 255 << 16;
#undef step
#undef steps
}

void text(size_t i, size_t j, cell_t c)
{
    char s[10];
    size_t len;

    if(!c) return;

    sprintf(s, "%d", 1 << ((int)c));
    len = strlen(s);

    SDL_Color color = { 255, 255, 255, 0 };
    SDL_Surface* string = TTF_RenderText_Solid(font, s, color);
    SDL_Rect rect = { j * 100 + 25, i * 100 + 25, 50, 50 };
    SDL_BlitSurface(string, NULL, window, &rect);
    SDL_FreeSurface(string);
}

static void draw()
{
    size_t i, j;
    SDL_Rect rect = { 0, 0, 100, 100 };
    for(i = 0; i < 4; ++i) {
        rect.y = i * 100;
        for(j = 0; j < 4; ++j) {
            rect.x = j * 100;
            SDL_FillRect(window, &rect, getColor(board[i * 4 + j]));
            text(i, j, board[i * 4 + j]);
        }
    }
}

static SDLCALL Uint32 ontimer(Uint32 interval)
{
    if(direction != NONE) {
        if(shift[direction]()) addRandomTile();
        direction = NONE;
    }
    draw();
    SDL_UpdateRect(window, 0, 0, 0, 0);
    SDL_Flip(window);
    if(!looping) return 0;
    else return interval;
}

void init_display(int* argc, char* argv[])
{
    SDL_Init(SDL_INIT_TIMER|SDL_INIT_VIDEO);
    TTF_Init();

    font = TTF_OpenFont("FreeMono.ttf", 36);
    if(!font) {
        SDL_Quit();
        abort();
    }

    window = SDL_SetVideoMode(400, 400, 24, SDL_HWSURFACE);
    SDL_WM_SetCaption("2048", "2048");

    SDL_SetTimer(17, &ontimer);

    looping = 0;
}

void loop()
{
    looping = 1;

    while(looping) {
        SDL_Event event;

        while(SDL_PollEvent(&event)) {
            switch(event.type) {
            case SDL_QUIT:
                looping = 0;
                break;
            case SDL_KEYDOWN:
                switch(event.key.keysym.sym) {
                case SDLK_ESCAPE:
                    looping = 0;
                    break;
                case SDLK_UP:
                    direction = UP;
                    break;
                case SDLK_LEFT:
                    direction = LEFT;
                    break;
                case SDLK_DOWN:
                    direction = DOWN;
                    break;
                case SDLK_RIGHT:
                    direction = RIGHT;
                    break;
                }
                break;
            }
        }
    }

    SDL_SetTimer(0, NULL);
    SDL_Delay(20); // why? :'(
    SDL_FreeSurface(window);
    TTF_Quit();
    SDL_Quit();
}

Added t2048/header.h.



















































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
#ifndef HEADER_H
#define HEADER_H

#ifdef __cplusplus
extern "C" {
#endif

typedef enum { NONE = 0, UP = 1, LEFT = 2, DOWN = 3, RIGHT = 4 } direction_t;
typedef unsigned char cell_t;

typedef int (*shift_fn)();

extern shift_fn shift[5];
extern cell_t board[16];

extern void init_display(int*, char* argv[]);
extern void loop();

extern void addRandomTile();

#ifdef __cplusplus
}
#endif

#endif

Added t2048/vendor/SDL-1.2.15/BUGS.





































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18

Bugs are now managed in the SDL bug tracker, here:

    http://bugzilla.libsdl.org/

You may report bugs there, and search to see if a given issue has already
 been reported, discussed, and maybe even fixed.



You may also find help at the SDL mailing list. Subscription information:

    http://lists.libsdl.org/listinfo.cgi/sdl-libsdl.org

Bug reports are welcome here, but we really appreciate if you use Bugzilla, as
 bugs discussed on the mailing list may be forgotten or missed.


Added t2048/vendor/SDL-1.2.15/COPYING.





















































































































































































































































































































































































































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
		  GNU LESSER GENERAL PUBLIC LICENSE
		       Version 2.1, February 1999

 Copyright (C) 1991, 1999 Free Software Foundation, Inc.
     51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA
 Everyone is permitted to copy and distribute verbatim copies
 of this license document, but changing it is not allowed.

[This is the first released version of the Lesser GPL.  It also counts
 as the successor of the GNU Library Public License, version 2, hence
 the version number 2.1.]

			    Preamble

  The licenses for most software are designed to take away your
freedom to share and change it.  By contrast, the GNU General Public
Licenses are intended to guarantee your freedom to share and change
free software--to make sure the software is free for all its users.

  This license, the Lesser General Public License, applies to some
specially designated software packages--typically libraries--of the
Free Software Foundation and other authors who decide to use it.  You
can use it too, but we suggest you first think carefully about whether
this license or the ordinary General Public License is the better
strategy to use in any particular case, based on the explanations below.

  When we speak of free software, we are referring to freedom of use,
not price.  Our General Public Licenses are designed to make sure that
you have the freedom to distribute copies of free software (and charge
for this service if you wish); that you receive source code or can get
it if you want it; that you can change the software and use pieces of
it in new free programs; and that you are informed that you can do
these things.

  To protect your rights, we need to make restrictions that forbid
distributors to deny you these rights or to ask you to surrender these
rights.  These restrictions translate to certain responsibilities for
you if you distribute copies of the library or if you modify it.

  For example, if you distribute copies of the library, whether gratis
or for a fee, you must give the recipients all the rights that we gave
you.  You must make sure that they, too, receive or can get the source
code.  If you link other code with the library, you must provide
complete object files to the recipients, so that they can relink them
with the library after making changes to the library and recompiling
it.  And you must show them these terms so they know their rights.

  We protect your rights with a two-step method: (1) we copyright the
library, and (2) we offer you this license, which gives you legal
permission to copy, distribute and/or modify the library.

  To protect each distributor, we want to make it very clear that
there is no warranty for the free library.  Also, if the library is
modified by someone else and passed on, the recipients should know
that what they have is not the original version, so that the original
author's reputation will not be affected by problems that might be
introduced by others.
 
  Finally, software patents pose a constant threat to the existence of
any free program.  We wish to make sure that a company cannot
effectively restrict the users of a free program by obtaining a
restrictive license from a patent holder.  Therefore, we insist that
any patent license obtained for a version of the library must be
consistent with the full freedom of use specified in this license.

  Most GNU software, including some libraries, is covered by the
ordinary GNU General Public License.  This license, the GNU Lesser
General Public License, applies to certain designated libraries, and
is quite different from the ordinary General Public License.  We use
this license for certain libraries in order to permit linking those
libraries into non-free programs.

  When a program is linked with a library, whether statically or using
a shared library, the combination of the two is legally speaking a
combined work, a derivative of the original library.  The ordinary
General Public License therefore permits such linking only if the
entire combination fits its criteria of freedom.  The Lesser General
Public License permits more lax criteria for linking other code with
the library.

  We call this license the "Lesser" General Public License because it
does Less to protect the user's freedom than the ordinary General
Public License.  It also provides other free software developers Less
of an advantage over competing non-free programs.  These disadvantages
are the reason we use the ordinary General Public License for many
libraries.  However, the Lesser license provides advantages in certain
special circumstances.

  For example, on rare occasions, there may be a special need to
encourage the widest possible use of a certain library, so that it becomes
a de-facto standard.  To achieve this, non-free programs must be
allowed to use the library.  A more frequent case is that a free
library does the same job as widely used non-free libraries.  In this
case, there is little to gain by limiting the free library to free
software only, so we use the Lesser General Public License.

  In other cases, permission to use a particular library in non-free
programs enables a greater number of people to use a large body of
free software.  For example, permission to use the GNU C Library in
non-free programs enables many more people to use the whole GNU
operating system, as well as its variant, the GNU/Linux operating
system.

  Although the Lesser General Public License is Less protective of the
users' freedom, it does ensure that the user of a program that is
linked with the Library has the freedom and the wherewithal to run
that program using a modified version of the Library.

  The precise terms and conditions for copying, distribution and
modification follow.  Pay close attention to the difference between a
"work based on the library" and a "work that uses the library".  The
former contains code derived from the library, whereas the latter must
be combined with the library in order to run.
 
		  GNU LESSER GENERAL PUBLIC LICENSE
   TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION

  0. This License Agreement applies to any software library or other
program which contains a notice placed by the copyright holder or
other authorized party saying it may be distributed under the terms of
this Lesser General Public License (also called "this License").
Each licensee is addressed as "you".

  A "library" means a collection of software functions and/or data
prepared so as to be conveniently linked with application programs
(which use some of those functions and data) to form executables.

  The "Library", below, refers to any such software library or work
which has been distributed under these terms.  A "work based on the
Library" means either the Library or any derivative work under
copyright law: that is to say, a work containing the Library or a
portion of it, either verbatim or with modifications and/or translated
straightforwardly into another language.  (Hereinafter, translation is
included without limitation in the term "modification".)

  "Source code" for a work means the preferred form of the work for
making modifications to it.  For a library, complete source code means
all the source code for all modules it contains, plus any associated
interface definition files, plus the scripts used to control compilation
and installation of the library.

  Activities other than copying, distribution and modification are not
covered by this License; they are outside its scope.  The act of
running a program using the Library is not restricted, and output from
such a program is covered only if its contents constitute a work based
on the Library (independent of the use of the Library in a tool for
writing it).  Whether that is true depends on what the Library does
and what the program that uses the Library does.
  
  1. You may copy and distribute verbatim copies of the Library's
complete source code as you receive it, in any medium, provided that
you conspicuously and appropriately publish on each copy an
appropriate copyright notice and disclaimer of warranty; keep intact
all the notices that refer to this License and to the absence of any
warranty; and distribute a copy of this License along with the
Library.

  You may charge a fee for the physical act of transferring a copy,
and you may at your option offer warranty protection in exchange for a
fee.
 
  2. You may modify your copy or copies of the Library or any portion
of it, thus forming a work based on the Library, and copy and
distribute such modifications or work under the terms of Section 1
above, provided that you also meet all of these conditions:

    a) The modified work must itself be a software library.

    b) You must cause the files modified to carry prominent notices
    stating that you changed the files and the date of any change.

    c) You must cause the whole of the work to be licensed at no
    charge to all third parties under the terms of this License.

    d) If a facility in the modified Library refers to a function or a
    table of data to be supplied by an application program that uses
    the facility, other than as an argument passed when the facility
    is invoked, then you must make a good faith effort to ensure that,
    in the event an application does not supply such function or
    table, the facility still operates, and performs whatever part of
    its purpose remains meaningful.

    (For example, a function in a library to compute square roots has
    a purpose that is entirely well-defined independent of the
    application.  Therefore, Subsection 2d requires that any
    application-supplied function or table used by this function must
    be optional: if the application does not supply it, the square
    root function must still compute square roots.)

These requirements apply to the modified work as a whole.  If
identifiable sections of that work are not derived from the Library,
and can be reasonably considered independent and separate works in
themselves, then this License, and its terms, do not apply to those
sections when you distribute them as separate works.  But when you
distribute the same sections as part of a whole which is a work based
on the Library, the distribution of the whole must be on the terms of
this License, whose permissions for other licensees extend to the
entire whole, and thus to each and every part regardless of who wrote
it.

Thus, it is not the intent of this section to claim rights or contest
your rights to work written entirely by you; rather, the intent is to
exercise the right to control the distribution of derivative or
collective works based on the Library.

In addition, mere aggregation of another work not based on the Library
with the Library (or with a work based on the Library) on a volume of
a storage or distribution medium does not bring the other work under
the scope of this License.

  3. You may opt to apply the terms of the ordinary GNU General Public
License instead of this License to a given copy of the Library.  To do
this, you must alter all the notices that refer to this License, so
that they refer to the ordinary GNU General Public License, version 2,
instead of to this License.  (If a newer version than version 2 of the
ordinary GNU General Public License has appeared, then you can specify
that version instead if you wish.)  Do not make any other change in
these notices.
 
  Once this change is made in a given copy, it is irreversible for
that copy, so the ordinary GNU General Public License applies to all
subsequent copies and derivative works made from that copy.

  This option is useful when you wish to copy part of the code of
the Library into a program that is not a library.

  4. You may copy and distribute the Library (or a portion or
derivative of it, under Section 2) in object code or executable form
under the terms of Sections 1 and 2 above provided that you accompany
it with the complete corresponding machine-readable source code, which
must be distributed under the terms of Sections 1 and 2 above on a
medium customarily used for software interchange.

  If distribution of object code is made by offering access to copy
from a designated place, then offering equivalent access to copy the
source code from the same place satisfies the requirement to
distribute the source code, even though third parties are not
compelled to copy the source along with the object code.

  5. A program that contains no derivative of any portion of the
Library, but is designed to work with the Library by being compiled or
linked with it, is called a "work that uses the Library".  Such a
work, in isolation, is not a derivative work of the Library, and
therefore falls outside the scope of this License.

  However, linking a "work that uses the Library" with the Library
creates an executable that is a derivative of the Library (because it
contains portions of the Library), rather than a "work that uses the
library".  The executable is therefore covered by this License.
Section 6 states terms for distribution of such executables.

  When a "work that uses the Library" uses material from a header file
that is part of the Library, the object code for the work may be a
derivative work of the Library even though the source code is not.
Whether this is true is especially significant if the work can be
linked without the Library, or if the work is itself a library.  The
threshold for this to be true is not precisely defined by law.

  If such an object file uses only numerical parameters, data
structure layouts and accessors, and small macros and small inline
functions (ten lines or less in length), then the use of the object
file is unrestricted, regardless of whether it is legally a derivative
work.  (Executables containing this object code plus portions of the
Library will still fall under Section 6.)

  Otherwise, if the work is a derivative of the Library, you may
distribute the object code for the work under the terms of Section 6.
Any executables containing that work also fall under Section 6,
whether or not they are linked directly with the Library itself.
 
  6. As an exception to the Sections above, you may also combine or
link a "work that uses the Library" with the Library to produce a
work containing portions of the Library, and distribute that work
under terms of your choice, provided that the terms permit
modification of the work for the customer's own use and reverse
engineering for debugging such modifications.

  You must give prominent notice with each copy of the work that the
Library is used in it and that the Library and its use are covered by
this License.  You must supply a copy of this License.  If the work
during execution displays copyright notices, you must include the
copyright notice for the Library among them, as well as a reference
directing the user to the copy of this License.  Also, you must do one
of these things:

    a) Accompany the work with the complete corresponding
    machine-readable source code for the Library including whatever
    changes were used in the work (which must be distributed under
    Sections 1 and 2 above); and, if the work is an executable linked
    with the Library, with the complete machine-readable "work that
    uses the Library", as object code and/or source code, so that the
    user can modify the Library and then relink to produce a modified
    executable containing the modified Library.  (It is understood
    that the user who changes the contents of definitions files in the
    Library will not necessarily be able to recompile the application
    to use the modified definitions.)

    b) Use a suitable shared library mechanism for linking with the
    Library.  A suitable mechanism is one that (1) uses at run time a
    copy of the library already present on the user's computer system,
    rather than copying library functions into the executable, and (2)
    will operate properly with a modified version of the library, if
    the user installs one, as long as the modified version is
    interface-compatible with the version that the work was made with.

    c) Accompany the work with a written offer, valid for at
    least three years, to give the same user the materials
    specified in Subsection 6a, above, for a charge no more
    than the cost of performing this distribution.

    d) If distribution of the work is made by offering access to copy
    from a designated place, offer equivalent access to copy the above
    specified materials from the same place.

    e) Verify that the user has already received a copy of these
    materials or that you have already sent this user a copy.

  For an executable, the required form of the "work that uses the
Library" must include any data and utility programs needed for
reproducing the executable from it.  However, as a special exception,
the materials to be distributed need not include anything that is
normally distributed (in either source or binary form) with the major
components (compiler, kernel, and so on) of the operating system on
which the executable runs, unless that component itself accompanies
the executable.

  It may happen that this requirement contradicts the license
restrictions of other proprietary libraries that do not normally
accompany the operating system.  Such a contradiction means you cannot
use both them and the Library together in an executable that you
distribute.
 
  7. You may place library facilities that are a work based on the
Library side-by-side in a single library together with other library
facilities not covered by this License, and distribute such a combined
library, provided that the separate distribution of the work based on
the Library and of the other library facilities is otherwise
permitted, and provided that you do these two things:

    a) Accompany the combined library with a copy of the same work
    based on the Library, uncombined with any other library
    facilities.  This must be distributed under the terms of the
    Sections above.

    b) Give prominent notice with the combined library of the fact
    that part of it is a work based on the Library, and explaining
    where to find the accompanying uncombined form of the same work.

  8. You may not copy, modify, sublicense, link with, or distribute
the Library except as expressly provided under this License.  Any
attempt otherwise to copy, modify, sublicense, link with, or
distribute the Library is void, and will automatically terminate your
rights under this License.  However, parties who have received copies,
or rights, from you under this License will not have their licenses
terminated so long as such parties remain in full compliance.

  9. You are not required to accept this License, since you have not
signed it.  However, nothing else grants you permission to modify or
distribute the Library or its derivative works.  These actions are
prohibited by law if you do not accept this License.  Therefore, by
modifying or distributing the Library (or any work based on the
Library), you indicate your acceptance of this License to do so, and
all its terms and conditions for copying, distributing or modifying
the Library or works based on it.

  10. Each time you redistribute the Library (or any work based on the
Library), the recipient automatically receives a license from the
original licensor to copy, distribute, link with or modify the Library
subject to these terms and conditions.  You may not impose any further
restrictions on the recipients' exercise of the rights granted herein.
You are not responsible for enforcing compliance by third parties with
this License.
 
  11. If, as a consequence of a court judgment or allegation of patent
infringement or for any other reason (not limited to patent issues),
conditions are imposed on you (whether by court order, agreement or
otherwise) that contradict the conditions of this License, they do not
excuse you from the conditions of this License.  If you cannot
distribute so as to satisfy simultaneously your obligations under this
License and any other pertinent obligations, then as a consequence you
may not distribute the Library at all.  For example, if a patent
license would not permit royalty-free redistribution of the Library by
all those who receive copies directly or indirectly through you, then
the only way you could satisfy both it and this License would be to
refrain entirely from distribution of the Library.

If any portion of this section is held invalid or unenforceable under any
particular circumstance, the balance of the section is intended to apply,
and the section as a whole is intended to apply in other circumstances.

It is not the purpose of this section to induce you to infringe any
patents or other property right claims or to contest validity of any
such claims; this section has the sole purpose of protecting the
integrity of the free software distribution system which is
implemented by public license practices.  Many people have made
generous contributions to the wide range of software distributed
through that system in reliance on consistent application of that
system; it is up to the author/donor to decide if he or she is willing
to distribute software through any other system and a licensee cannot
impose that choice.

This section is intended to make thoroughly clear what is believed to
be a consequence of the rest of this License.

  12. If the distribution and/or use of the Library is restricted in
certain countries either by patents or by copyrighted interfaces, the
original copyright holder who places the Library under this License may add
an explicit geographical distribution limitation excluding those countries,
so that distribution is permitted only in or among countries not thus
excluded.  In such case, this License incorporates the limitation as if
written in the body of this License.

  13. The Free Software Foundation may publish revised and/or new
versions of the Lesser General Public License from time to time.
Such new versions will be similar in spirit to the present version,
but may differ in detail to address new problems or concerns.

Each version is given a distinguishing version number.  If the Library
specifies a version number of this License which applies to it and
"any later version", you have the option of following the terms and
conditions either of that version or of any later version published by
the Free Software Foundation.  If the Library does not specify a
license version number, you may choose any version ever published by
the Free Software Foundation.
 
  14. If you wish to incorporate parts of the Library into other free
programs whose distribution conditions are incompatible with these,
write to the author to ask for permission.  For software which is
copyrighted by the Free Software Foundation, write to the Free
Software Foundation; we sometimes make exceptions for this.  Our
decision will be guided by the two goals of preserving the free status
of all derivatives of our free software and of promoting the sharing
and reuse of software generally.

			    NO WARRANTY

  15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO
WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW.
EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR
OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY
KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE
IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR
PURPOSE.  THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE
LIBRARY IS WITH YOU.  SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME
THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION.

  16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN
WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY
AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU
FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR
CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE
LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING
RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A
FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF
SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH
DAMAGES.

		     END OF TERMS AND CONDITIONS

Added t2048/vendor/SDL-1.2.15/INSTALL.















































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23

To compile and install SDL:

    1.  Run './configure; make; make install'

        If you are compiling for Windows using gcc, read the FAQ at:
        http://www.libsdl.org/faq.php?action=listentries&category=4#42

        If you are compiling using Visual C++ on Win32, you should read
        the file VisualC.html

    2.  Look at the example programs in ./test, and check out the HTML
        documentation in ./docs to see how to use the SDL library.

    3.  Join the SDL developer mailing list by sending E-mail to
    	sdl-request@libsdl.org
        and put "subscribe" in the subject of the message.

        Or alternatively you can use the web interface:
            http://www.libsdl.org/mailing-list.php

That's it!
Sam Lantinga <slouken@libsdl.org>

Added t2048/vendor/SDL-1.2.15/Makefile.



















































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
#
# Makefile for installing the Mingw32 version of the SDL library

CROSS_PATH := /usr/local/cross-tools/i686-w64-mingw32

all:
	@echo "Type \"make native\" to install to /usr"
	@echo "Type \"make cross\" to install to $(CROSS_PATH)"

native:
	make install-sdl prefix=/usr

cross:
	make install-sdl prefix=$(CROSS_PATH)

install-sdl:
	if test -d $(prefix); then \
	    cp -rv bin include lib share $(prefix)/; \
	    sed "s|^prefix=.*|prefix=$(prefix)|" <bin/sdl-config >$(prefix)/bin/sdl-config; \
	    chmod 755 $(prefix)/bin/sdl-config; \
	    sed "s|^libdir=.*|libdir=\'$(prefix)/lib\'|" <lib/libSDL.la >$(prefix)/lib/libSDL.la; \
	else \
	    echo "*** ERROR: $(prefix) does not exist!"; \
	    exit 1; \
	fi

Added t2048/vendor/SDL-1.2.15/README.



































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49

                         Simple DirectMedia Layer

                                  (SDL)

                                Version 1.2

---
http://www.libsdl.org/

This is the Simple DirectMedia Layer, a general API that provides low
level access to audio, keyboard, mouse, joystick, 3D hardware via OpenGL,
and 2D framebuffer across multiple platforms.

The current version supports Linux, Windows CE/95/98/ME/XP/Vista, BeOS,
MacOS Classic, Mac OS X, FreeBSD, NetBSD, OpenBSD, BSD/OS, Solaris, IRIX,
and QNX.  The code contains support for Dreamcast, Atari, AIX, OSF/Tru64,
RISC OS, SymbianOS, Nintendo DS, and OS/2, but these are not officially
supported.

SDL is written in C, but works with C++ natively, and has bindings to
several other languages, including Ada, C#, Eiffel, Erlang, Euphoria,
Guile, Haskell, Java, Lisp, Lua, ML, Objective C, Pascal, Perl, PHP,
Pike, Pliant, Python, Ruby, and Smalltalk.

This library is distributed under GNU LGPL version 2, which can be
found in the file  "COPYING".  This license allows you to use SDL
freely in commercial programs as long as you link with the dynamic
library.

The best way to learn how to use SDL is to check out the header files in
the "include" subdirectory and the programs in the "test" subdirectory.
The header files and test programs are well commented and always up to date.
More documentation is available in HTML format in "docs/index.html", and
a documentation wiki is available online at:
	http://www.libsdl.org/cgi/docwiki.cgi

The test programs in the "test" subdirectory are in the public domain.

Frequently asked questions are answered online:
	http://www.libsdl.org/faq.php

If you need help with the library, or just want to discuss SDL related
issues, you can join the developers mailing list:
	http://www.libsdl.org/mailing-list.php

Enjoy!
	Sam Lantinga				(slouken@libsdl.org)

Added t2048/vendor/SDL-1.2.15/README-SDL.txt.



























>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13

Please distribute this file with the SDL runtime environment:

The Simple DirectMedia Layer (SDL for short) is a cross-platfrom library
designed to make it easy to write multi-media software, such as games and
emulators.

The Simple DirectMedia Layer library source code is available from:
http://www.libsdl.org/

This library is distributed under the terms of the GNU LGPL license:
http://www.gnu.org/copyleft/lesser.html

Added t2048/vendor/SDL-1.2.15/SOMEFILESDELETED.

Added t2048/vendor/SDL-1.2.15/WhatsNew.















































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
459
460
461
462
463
464
465
466
467
468
469
470
471
472
473
474
475
476
477
478
479
480
481
482
483
484
485
486
487
488
489
490
491
492
493
494
495
496
497
498
499
500
501
502
503
504
505
506
507
508
509
510
511
512
513
514
515
516
517
518
519
520
521
522
523
524
525
526
527
528
529
530
531
532
533
534
535
536
537
538
539
540
541
542
543
544
545
546
547
548
549
550
551
552
553
554
555
556
557
558
559
560
561
562
563
564
565
566
567
568
569
570
571
572
573
574
575
576
577
578
579
580
581
582
583
584
585
586
587
588
589
590
591
592
593
594
595
596
597
598
599
600
601
602
603
604
605
606
607
608
609
610
611
612
613
614
615
616
617
618
619
620
621
622
623
624
625
626
627
628
629
630
631
632
633
634
635
636
637
638
639
640
641
642
643
644
645
646
647
648
649
650
651
652
653
654
655
656
657
658
659
660
661
662
663
664
665
666
667
668
669
670
671
672
673
674
675
676
677
678
679
680
681
682
683
684
685
686
687
688
689
690
691
692
693
694
695
696
697
698
699
700
701
702
703
704
705
706
707
708
709
710
711
712
713
714
715
716
717
718
719
720
721
722
723
724
725
726
727

This is a list of API changes in SDL's version history.

Version 1.0:

1.2.14:
	Added cast macros for correct usage with C++:
		SDL_reinterpret_cast(type, expression)
		SDL_static_cast(type, expression)

	Added SDL_VIDEO_FULLSCREEN_DISPLAY as a preferred synonym for 
	SDL_VIDEO_FULLSCREEN_HEAD on X11.

	Added SDL_DISABLE_LOCK_KEYS environment variable to enable normal
	up/down events for Caps-Lock and Num-Lock keys.

1.2.13:
	Added SDL_BUTTON_X1 and SDL_BUTTON_X2 constants.

1.2.12:
	Added SDL_VIDEO_ALLOW_SCREENSAVER to override SDL's disabling
	of the screensaver on Mac OS X and X11.

1.2.10:
	If SDL_OpenAudio() is passed zero for the desired format
	fields, the following environment variables will be used
	to fill them in:
		SDL_AUDIO_FREQUENCY
		SDL_AUDIO_FORMAT
		SDL_AUDIO_CHANNELS
		SDL_AUDIO_SAMPLES
	If an environment variable is not specified, it will be set
	to a reasonable default value.

	Added support for the SDL_VIDEO_FULLSCREEN_HEAD environment
	variable, currently supported on X11 Xinerama configurations.

	Added SDL_GL_SWAP_CONTROL to wait for vsync in OpenGL applications.

	Added SDL_GL_ACCELERATED_VISUAL to guarantee hardware acceleration.

	Added current_w and current_h to the SDL_VideoInfo structure,
	which is set to the desktop resolution during video intialization,
	and then set to the current resolution when a video mode is set.

	SDL_SetVideoMode() now accepts 0 for width or height and will use
	the current video mode (or the desktop mode if no mode has been set.)

	Added SDL_GetKeyRepeat()

	Added SDL_config.h, with defaults for various build environments.

1.2.7:
	Added CPU feature detection functions to SDL_cpuinfo.h:
		SDL_HasRDTSC(), SDL_HasMMX(), SDL_Has3DNow(), SDL_HasSSE(),
		SDL_HasAltiVec()
	Added function to create RWops from const memory: SDL_RWFromConstMem()

1.2.6:
	Added SDL_LoadObject(), SDL_LoadFunction(), and SDL_UnloadObject()

	Added SDL_GL_MULTISAMPLEBUFFERS and SDL_GL_MULTISAMPLESAMPLES for FSAA

1.2.5:
	Added SDL_BUTTON_WHEELUP (4) and SDL_BUTTON_WHEELDOWN (5)

	Added SDL_GL_STEREO for stereoscopic OpenGL contexts

1.2.0:
	Added SDL_VIDEOEXPOSE event to signal that the screen needs to
	be redrawn.  This is currently only delivered to OpenGL windows
	on X11, though it may be delivered in the future when the video
	memory is lost under DirectX.

1.1.8:
	You can pass SDL_NOFRAME to SDL_VideoMode() to create a window
	that has no title bar or frame decoration.  Fullscreen video
	modes automatically have this flag set.

	Added a function to query the clipping rectangle for a surface:
		void SDL_GetClipRect(SDL_Surface *surface, SDL_Rect *rect)

	Added a function to query the current event filter:
		SDL_EventFilter SDL_GetEventFilter(void)

	If you pass -1 to SDL_ShowCursor(), it won't change the current
	cursor visibility state, but will still return it.

	SDL_LockSurface() and SDL_UnlockSurface() are recursive, meaning
	you can nest them as deep as you want, as long as each lock call
	has a matching unlock call.  The surface remains locked until the
	last matching unlock call.

	Note that you may not blit to or from a locked surface.

1.1.7:
	The SDL_SetGammaRamp() and SDL_GetGammaRamp() functions now take
	arrays of Uint16 values instead of Uint8 values.  For the most part,
	you can just take your old values and shift them up 8 bits to get
	new correct values for your gamma ramps.

	You can pass SDL_RLEACCEL in flags passed to SDL_ConvertSurface()
        and SDL will try to RLE accelerate colorkey and alpha blits in the
	resulting surface.

1.1.6:
	Added a function to return the thread ID of a specific thread:
		Uint32 SDL_GetThreadID(SDL_Thread *thread)
	If 'thread' is NULL, this function returns the id for this thread.

1.1.5:
	The YUV overlay structure has been changed to use an array of
	pitches and pixels representing the planes of a YUV image, to
	better enable hardware acceleration.  The YV12 and IYUV formats
	each have three planes, corresponding to the Y, U, and V portions
	of the image, while packed pixel YUV formats just have one plane.

	For palettized mode (8bpp), the screen colormap is now split in
	a physical and a logical palette. The physical palette determines
	what colours the screen pixels will get when displayed, and the
	logical palette controls the mapping from blits to/from the screen.
	A new function, SDL_SetPalette() has been added to change
	logical and physical palettes separately. SDL_SetColors() works
	just as before, and is equivalent to calling SDL_SetPalette() with
	a flag argument of (SDL_LOGPAL|SDL_PHYSPAL).

	SDL_BlitSurface() no longer modifies the source rectangle, only the
	destination rectangle. The width/height members of the destination
	rectangle are ignored, only the position is used.

	The old source clipping function SDL_SetClipping() has been replaced
	with a more useful function to set the destination clipping rectangle:
		SDL_bool SDL_SetClipRect(SDL_Surface *surface, SDL_Rect *rect)
		
	Added a function to see what subsystems have been initialized:
		Uint32 SDL_WasInit(Uint32 flags)

	The Big Alpha Flip: SDL now treats alpha as opacity like everybody
	else, and not as transparency:

	A new cpp symbol: SDL_ALPHA_OPAQUE is defined as 255
	A new cpp symbol: SDL_ALPHA_TRANSPARENT is defined as 0
	Values between 0 and 255 vary from fully transparent to fully opaque.

	New functions:
	SDL_DisplayFormatAlpha()
	    Returns a surface converted to a format with alpha-channel
	    that can be blit efficiently to the screen. (In other words,
	    like SDL_DisplayFormat() but the resulting surface has
	    an alpha channel.)  This is useful for surfaces with alpha.
	SDL_MapRGBA()
	    Works as SDL_MapRGB() but takes an additional alpha parameter.
	SDL_GetRGBA()
	    Works as SDL_GetRGB() but also returns the alpha value
	    (SDL_ALPHA_OPAQUE for formats without an alpha channel)

	Both SDL_GetRGB() and SDL_GetRGBA() now always return values in
	the [0..255] interval. Previously, SDL_GetRGB() would return
	(0xf8, 0xfc, 0xf8) for a completely white pixel in RGB565 format.
	(N.B.: This is broken for bit fields < 3 bits.)

	SDL_MapRGB() returns pixels in which the alpha channel is set opaque.

	SDL_SetAlpha() can now be used for both setting the per-surface
	alpha, using the new way of thinking of alpha, and also to enable
	and disable per-pixel alpha blending for surfaces with an alpha
	channel:
		To disable alpha blending:
			SDL_SetAlpha(surface, 0, 0);
		To re-enable alpha blending:
			SDL_SetAlpha(surface, SDL_SRCALPHA, 0);
	Surfaces with an alpha channel have blending enabled by default.

	SDL_SetAlpha() now accepts SDL_RLEACCEL as a flag, which requests
	RLE acceleration of blits, just as like with SDL_SetColorKey().
	This flag can be set for both surfaces with an alpha channel
	and surfaces with an alpha value set by SDL_SetAlpha().
	As always, RLE surfaces must be locked before pixel access is
	allowed, and unlocked before any other SDL operations are done
	on it.

	The blit semantics for surfaces with and without alpha and colorkey
	have now been defined:

	RGBA->RGB:
	    SDL_SRCALPHA set:
		alpha-blend (using alpha-channel).
		SDL_SRCCOLORKEY ignored.
	    SDL_SRCALPHA not set:
		copy RGB.
		if SDL_SRCCOLORKEY set, only copy the pixels matching the
		RGB values of the source colour key, ignoring alpha in the
		comparison.

	RGB->RGBA:
	    SDL_SRCALPHA set:
		alpha-blend (using the source per-surface alpha value);
		set destination alpha to opaque.
	    SDL_SRCALPHA not set:
		copy RGB, set destination alpha to opaque.
	    both:
		if SDL_SRCCOLORKEY set, only copy the pixels matching the
		source colour key.

	RGBA->RGBA:
	    SDL_SRCALPHA set:
		alpha-blend (using the source alpha channel) the RGB values;
		leave destination alpha untouched. [Note: is this correct?]
		SDL_SRCCOLORKEY ignored.
	    SDL_SRCALPHA not set:
		copy all of RGBA to the destination.
		if SDL_SRCCOLORKEY set, only copy the pixels matching the
		RGB values of the source colour key, ignoring alpha in the
		comparison.

	RGB->RGB: 
	    SDL_SRCALPHA set:
		alpha-blend (using the source per-surface alpha value).
	    SDL_SRCALPHA not set:
		copy RGB.
	    both:
		if SDL_SRCCOLORKEY set, only copy the pixels matching the
		source colour key.

	As a special case, blits from surfaces with per-surface alpha
	value of 128 (50% transparency) are optimised and much faster
	than other alpha values. This does not apply to surfaces with
	alpha channels (per-pixel alpha).

	New functions for manipulating the gamma of the display have
	been added:
		int SDL_SetGamma(float red, float green, float blue);
		int SDL_SetGammaRamp(Uint8 *red, Uint8 *green, Uint8 *blue);
		int SDL_GetGammaRamp(Uint8 *red, Uint8 *green, Uint8 *blue);
	Gamma ramps are tables with 256 entries which map the screen color
	components into actually displayed colors.  For an example of
	implementing gamma correction and gamma fades, see test/testgamma.c
	Gamma control is not supported on all hardware.

1.1.4:
	The size of the SDL_CDtrack structure changed from 8 to 12 bytes
	as the size of the length member was extended to 32 bits.

        You can now use SDL for 2D blitting with a GL mode by passing the
	SDL_OPENGLBLIT flag to SDL_SetVideoMode().  You can specify 16 or
	32 bpp, and the data in the framebuffer is put into the GL scene
	when you call SDL_UpdateRects(), and the scene will be visible
	when you call SDL_GL_SwapBuffers().

	Run the "testgl" test program with the -logo command line option
	to see an example of this blending of 2D and 3D in SDL.

1.1.3:
	Added SDL_FreeRW() to the API, to complement SDL_AllocRW()

	Added resizable window support - just add SDL_RESIZABLE to the
	SDL_SetVideoMode() flags, and then wait for SDL_VIDEORESIZE events.
	See SDL_events.h for details on the new SDL_ResizeEvent structure.

	Added condition variable support, based on mutexes and semaphores.
		SDL_CreateCond()
		SDL_DestroyCond()
		SDL_CondSignal()
		SDL_CondBroadcast()
		SDL_CondWait()
		SDL_CondTimedWait()
	The new function prototypes are in SDL_mutex.h

	Added counting semaphore support, based on the mutex primitive.
		SDL_CreateSemaphore()
		SDL_DestroySemaphore()
		SDL_SemWait()
		SDL_SemTryWait()
		SDL_SemWaitTimeout()
		SDL_SemPost()
		SDL_SemValue()
	The new function prototypes are in SDL_mutex.h

	Added support for asynchronous blitting.  To take advantage of this,
	you must set the SDL_ASYNCBLIT flag when setting the video mode and
	creating surfaces that you want accelerated in this way.  You must
	lock surfaces that have this flag set, and the lock will block until
	any queued blits have completed.

	Added YUV video overlay support.
	The supported YUV formats are: YV12, IYUV, YUY2, UYVY, and YVYU.
	This function creates an overlay surface:
		SDL_CreateYUVOverlay()
	You must lock and unlock the overlay to get access to the data:
		SDL_LockYUVOverlay() SDL_UnlockYUVOverlay()
	You can then display the overlay:
		SDL_DisplayYUVOverlay()
	You must free the overlay when you are done using it:
		SDL_FreeYUVOverlay()
	See SDL_video.h for the full function prototypes.

	The joystick hat position constants have been changed:
	Old constant            New constant
	------------            ------------
	     0                  SDL_HAT_CENTERED
	     1                  SDL_HAT_UP
	     2                  SDL_HAT_RIGHTUP
	     3                  SDL_HAT_RIGHT
	     4                  SDL_HAT_RIGHTDOWN
	     5                  SDL_HAT_DOWN
	     6                  SDL_HAT_LEFTDOWN
	     7                  SDL_HAT_LEFT
	     8                  SDL_HAT_LEFTUP
	The new constants are bitmasks, so you can check for the
	individual axes like this:
		if ( hat_position & SDL_HAT_UP ) {
		}
	and you'll catch left-up, up, and right-up.

1.1.2:
	Added multiple timer support:
		SDL_AddTimer() and SDL_RemoveTimer()

	SDL_WM_SetIcon() now respects the icon colorkey if mask is NULL.

1.1.0:
	Added initial OpenGL support.
	First set GL attributes (such as RGB depth, alpha depth, etc.)
		SDL_GL_SetAttribute()
	Then call SDL_SetVideoMode() with the SDL_OPENGL flag.
	Perform all of your normal GL drawing.
	Finally swap the buffers with the new SDL function:
		SDL_GL_SwapBuffers()
	See the new 'testgl' test program for an example of using GL with SDL.

	You can load GL extension functions by using the function:
		SDL_GL_LoadProcAddress()

	Added functions to initialize and cleanup specific SDL subsystems:
		SDL_InitSubSystem() and SDL_QuitSubSystem()

	Added user-defined event type:
		typedef struct {
        		Uint8 type;
        		int code;
        		void *data1;
        		void *data2;
		} SDL_UserEvent;
	This structure is in the "user" member of an SDL_Event.

	Added a function to push events into the event queue:
		SDL_PushEvent()

	Example of using the new SDL user-defined events:
	{
		SDL_Event event;

		event.type = SDL_USEREVENT;
		event.user.code = my_event_code;
		event.user.data1 = significant_data;
		event.user.data2 = 0;
		SDL_PushEvent(&event);
	}

	Added a function to get mouse deltas since last query:
		SDL_GetRelativeMouseState()

	Added a boolean datatype to SDL_types.h:
		SDL_bool = { SDL_TRUE, SDL_FALSE }

	Added a function to get the current audio status:
		SDL_GetAudioState();
	It returns one of:
		SDL_AUDIO_STOPPED,
		SDL_AUDIO_PLAYING,
		SDL_AUDIO_PAUSED

	Added an AAlib driver (ASCII Art) - by Stephane Peter.

1.0.6:
	The input grab state is reset after each call to SDL_SetVideoMode().
	The input is grabbed by default in fullscreen mode, and ungrabbed in
	windowed mode.  If you want to set input grab to a particular value,
	you should set it after each call to SDL_SetVideoMode().

1.0.5:
	Exposed SDL_AudioInit(), SDL_VideoInit()
	Added SDL_AudioDriverName() and SDL_VideoDriverName()

	Added new window manager function:
		SDL_WM_ToggleFullScreen()
	This is currently implemented only on Linux

	The ALT-ENTER code has been removed - it's not appropriate for a
	lib to bind keys when they aren't even emergency escape sequences.

	ALT-ENTER functionality can be implemented with the following code:

	int Handle_AltEnter(const SDL_Event *event)
	{
	    if ( event->type == SDL_KEYDOWN ) {
	        if ( (event->key.keysym.sym == SDLK_RETURN) &&
	             (event->key.keysym.mod & KMOD_ALT) ) {   
	                SDL_WM_ToggleFullScreen(SDL_GetVideoSurface());
	                return(0);
	        }
	    }
	    return(1);
	}
	SDL_SetEventFilter(Handle_AltEnter);

1.0.3:
	Under X11, if you grab the input and hide the mouse cursor,
	the mouse will go into a "relative motion" mode where you
	will always get relative motion events no matter how far in
	each direction you move the mouse - relative motion is not
	bounded by the edges of the window (though the absolute values
	of the mouse positions are clamped by the size of the window).
	The SVGAlib, framebuffer console, and DirectInput drivers all
	have this behavior naturally, and the GDI and BWindow drivers
	never go into "relative motion" mode.

1.0.2:
	Added a function to enable keyboard repeat:
		SDL_EnableKeyRepeat()

	Added a function to grab the mouse and keyboard input
		SDL_WM_GrabInput()

	Added a function to iconify the window.
		SDL_WM_IconifyWindow()
	If this function succeeds, the application will receive an event
	signaling SDL_APPACTIVE event 

1.0.1:
	Added constants to SDL_audio.h for 16-bit native byte ordering:
		AUDIO_U16SYS, AUDIO_S16SYS

1.0.0:
	New public release

Version 0.11:

0.11.5:
	A new function SDL_GetVideoSurface() has been added, and returns
	a pointer to the current display surface.

	SDL_AllocSurface() has been renamed SDL_CreateRGBSurface(), and
	a new function SDL_CreateRGBSurfaceFrom() has been added to allow
	creating an SDL surface from an existing pixel data buffer.

	Added SDL_GetRGB() to the headers and documentation.

0.11.4:
	SDL_SetLibraryPath() is no longer meaningful, and has been removed.

0.11.3:
	A new flag for SDL_Init(), SDL_INIT_NOPARACHUTE, prevents SDL from
	installing fatal signal handlers on operating systems that support
	them.

Version 0.9:

0.9.15:
	SDL_CreateColorCursor() has been removed.  Color cursors should
	be implemented as sprites, blitted by the application when the
	cursor moves.  To get smooth color cursor updates when the app
	is busy, pass the SDL_INIT_EVENTTHREAD flag to SDL_Init().  This
	allows you to handle the mouse motion in another thread from an
	event filter function, but is currently only supported by Linux
	and BeOS.  Note that you'll have to protect the display surface
	from multi-threaded access by using mutexes if you do this.

	Thread-safe surface support has been removed from SDL.
	This makes blitting somewhat faster, by removing SDL_MiddleBlit().
	Code that used SDL_MiddleBlit() should use SDL_LowerBlit() instead.
	You can make your surfaces thread-safe by allocating your own
	mutex and making lock/unlock calls around accesses to your surface.

0.9.14:
	SDL_GetMouseState() now takes pointers to int rather than Uint16.

	If you set the SDL_WINDOWID environment variable under UNIX X11,
	SDL will use that as the main window instead of creating it's own.
	This is an unsupported extension to SDL, and not portable at all.

0.9.13:
	Added a function SDL_SetLibraryPath() which can be used to specify
	the directory containing the SDL dynamic libraries.  This is useful
	for commercial applications which ship with particular versions
	of the libraries, and for security on multi-user systems.
	If this function is not used, the default system directories are 
	searched using the native dynamic object loading mechanism.

	In order to support C linkage under Visual C++, you must declare
	main() without any return type:
		main(int argc, char *argv[]) {
			/* Do the program... */
			return(0);
		}
	C++ programs should also return a value if compiled under VC++.

	The blit_endian member of the SDL_VideoInfo struct has been removed.

	SDL_SymToASCII() has been replaced with SDL_GetKeyName(), so there
	is now no longer any function to translate a keysym to a character.

	The SDL_keysym structure has been extended with a 'scancode' and
	'unicode' member.  The 'scancode' is a hardware specific scancode
	for the key that was pressed, and may be 0.  The 'unicode' member
	is a 16-bit UNICODE translation of the key that was pressed along
	with any modifiers or compose keys that have been pressed.
	If no UNICODE translation exists for the key, 'unicode' will be 0.

	Added a function SDL_EnableUNICODE() to enable/disable UNICODE
	translation of character keypresses.  Translation defaults off.

	To convert existing code to use the new API, change code which
	uses SDL_SymToASCII() to get the keyname to use SDL_GetKeyName(),
	and change code which uses it to get the ASCII value of a sym to
	use the 'unicode' member of the event keysym.

0.9.12:
	There is partial support for 64-bit datatypes.  I don't recommend 
	you use this if you have a choice, because 64-bit datatypes are not
	supported on many platforms.  On platforms for which it is supported,
	the SDL_HAS_64BIT_TYPE C preprocessor define will be enabled, and
	you can use the Uint64 and Sint64 datatypes.

	Added functions to SDL_endian.h to support 64-bit datatypes:
	    SDL_SwapLE64(), SDL_SwapBE64(),
	    SDL_ReadLE64(), SDL_ReadBE64(), SDL_WriteLE64(), SDL_WriteBE64()

	A new member "len_ratio" has been added to the SDL_AudioCVT structure,
	and allows you to determine either the original buffer length or the
	converted buffer length, given the other.

	A new function SDL_FreeWAV() has been added to the API to free data
	allocated by SDL_LoadWAV_RW().  This is necessary under Win32 since
	the gcc compiled DLL uses a different heap than VC++ compiled apps.

	SDL now has initial support for international keyboards using the
	Latin character set.
	If a particular mapping is desired, you can set the DEFAULT_KEYBOARD
	compile-time variable, or you can set the environment variable 
	"SDL_KEYBOARD" to a string identifying the keyboard mapping you desire.
	The valid values for these variables can be found in SDL_keyboard.c

	Full support for German and French keyboards under X11 is implemented.

0.9.11:
	The THREADED_EVENTS compile-time define has been replaced with the
	SDL_INIT_EVENTTHREAD flag.  If this flag is passed to SDL_Init(),
	SDL will create a separate thread to perform input event handling.
	If this flag is passed to SDL_Init(), and the OS doesn't support 
	event handling in a separate thread, SDL_Init() will fail.
	Be sure to add calls to SDL_Delay() in your main thread to allow
	the OS to schedule your event thread, or it may starve, leading
	to slow event delivery and/or dropped events.
	Currently MacOS and Win32 do not support this flag, while BeOS 
	and Linux do support it.  I recommend that your application only
	use this flag if absolutely necessary.

	The SDL thread function passed to SDL_CreateThread() now returns a
	status.  This status can be retrieved by passing a non-NULL pointer
	as the 'status' argument to SDL_WaitThread().

	The volume parameter to SDL_MixAudio() has been increased in range
	from (0-8) to (0-128)

	SDL now has a data source abstraction which can encompass a file,
	an area of memory, or any custom object you can envision.  It uses
	these abstractions, SDL_RWops, in the endian read/write functions,
	and the built-in WAV and BMP file loaders.  This means you can load
	WAV chunks from memory mapped files, compressed archives, network
	pipes, or anything else that has a data read abstraction.

	There are three built-in data source abstractions:
	    SDL_RWFromFile(), SDL_RWFromFP(), SDL_RWFromMem()
	along with a generic data source allocation function:
	    SDL_AllocRW()
	These data sources can be used like stdio file pointers with the
	following convenience functions:
	    SDL_RWseek(), SDL_RWread(), SDL_RWwrite(), SDL_RWclose()
	These functions are defined in the new header file "SDL_rwops.h"

	The endian swapping functions have been turned into macros for speed
	and SDL_CalculateEndian() has been removed.  SDL_endian.h now defines
	SDL_BYTEORDER as either SDL_BIG_ENDIAN or SDL_LIL_ENDIAN depending on
	the endianness of the host system.

	The endian read/write functions now take an SDL_RWops pointer
	instead of a stdio FILE pointer, to support the new data source
	abstraction.

	The SDL_*LoadWAV() functions have been replaced with a single
	SDL_LoadWAV_RW() function that takes a SDL_RWops pointer as it's
	first parameter, and a flag whether or not to automatically 
	free it as the second parameter.  SDL_LoadWAV() is a macro for
	backward compatibility and convenience:
	    SDL_LoadWAV_RW(SDL_RWFromFile("sample.wav", "rb"), 1, ...);

	The SDL_*LoadBMP()/SDL_*SaveBMP() functions have each been replaced
	with a single function that takes a SDL_RWops pointer as it's
	first parameter, and a flag whether or not to automatically 
	free it as the second parameter.  SDL_LoadBMP() and SDL_SaveBMP()
	are macros for backward compatibility and convenience:
	    SDL_LoadBMP_RW(SDL_RWFromFile("sample.bmp", "rb"), 1, ...);
	    SDL_SaveBMP_RW(SDL_RWFromFile("sample.bmp", "wb"), 1, ...);
	Note that these functions use SDL_RWseek() extensively, and should
	not be used on pipes or other non-seekable data sources.

0.9.10:
	The Linux SDL_SysWMInfo and SDL_SysWMMsg structures have been 
	extended to support multiple types of display drivers, as well as
        safe access to the X11 display when THREADED_EVENTS is enabled.
        The new structures are documented in the SDL_syswm.h header file.

	Thanks to John Elliott <jce@seasip.demon.co.uk>, the UK keyboard
	should now work properly, as well as the "Windows" keys on US
	keyboards.

	The Linux CD-ROM code now reads the CD-ROM devices from /etc/fstab
	instead of trying to open each block device on the system.
	The CD must be listed in /etc/fstab as using the iso9660 filesystem.

	On Linux, if you define THREADED_EVENTS at compile time, a separate
	thread will be spawned to gather X events asynchronously from the
	graphics updates.  This hasn't been extensively tested, but it does
	provide a means of handling keyboard and mouse input in a separate
	thread from the graphics thread.  (This is now enabled by default.)

	A special access function SDL_PeepEvents() allows you to manipulate
	the event queue in a thread-safe manner, including peeking at events,
	removing events of a specified type, and adding new events of arbitrary
	type to the queue (use the new 'user' member of the SDL_Event type).

	If you use SDL_PeepEvents() to gather events, then the main graphics
	thread needs to call SDL_PumpEvents() periodically to drive the event
	loop and generate input events.  This is not necessary if SDL has been 
	compiled with THREADED_EVENTS defined, but doesn't hurt.

	A new function SDL_ThreadID() returns the identifier associated with
	the current thread.

0.9.9:
	The AUDIO_STEREO format flag has been replaced with a new 'channels'
	member of the SDL_AudioSpec structure.  The channels are 1 for mono
	audio, and 2 for stereo audio.  In the future more channels may be
	supported for 3D surround sound.

	The SDL_MixAudio() function now takes an additional volume parameter,
	which should be set to SDL_MIX_MAXVOLUME for compatibility with the
	original function.

	The CD-ROM functions which take a 'cdrom' parameter can now be
	passed NULL, and will act on the last successfully opened CD-ROM.

0.9.8:
	No changes, bugfixes only.
	
0.9.7:
	No changes, bugfixes only.
	
0.9.6:
	Added a fast rectangle fill function: SDL_FillRect()

	Addition of a useful function for getting info on the video hardware:
	    const SDL_VideoInfo *SDL_GetVideoInfo(void)
        This function replaces SDL_GetDisplayFormat().

	Initial support for double-buffering:
	  Use the SDL_DOUBLEBUF flag in SDL_SetVideoMode()
	  Update the screen with a new function: SDL_Flip()

	SDL_AllocSurface() takes two new flags:
	SDL_SRCCOLORKEY means that the surface will be used for colorkey blits
	  and if the hardware supports hardware acceleration of colorkey blits
	  between two surfaces in video memory, to place the surface in video
	  memory if possible, otherwise it will be placed in system memory.
	SDL_SRCALPHA means that the surface will be used for alpha blits and
	  if the hardware supports hardware acceleration of alpha blits between
	  two surfaces in video memory, to place the surface in video memory
	  if possible, otherwise it will be placed in system memory.
	SDL_HWSURFACE now means that the surface will be created with the 
	  same format as the display surface, since having surfaces in video
	  memory is only useful for fast blitting to the screen, and you can't
	  blit surfaces with different surface formats in video memory.

0.9.5:
	You can now pass a NULL mask to SDL_WM_SetIcon(), and it will assume
	that the icon consists of the entire image.

	SDL_LowerBlit() is back -- but don't use it on the display surface.
	It is exactly the same as SDL_MiddleBlit(), but doesn't check for
	thread safety.

	Added SDL_FPLoadBMP(), SDL_FPSaveBMP(), SDL_FPLoadWAV(), which take
	a FILE pointer instead of a file name.

	Added CD-ROM audio control API:
	    SDL_CDNumDrives()
	    SDL_CDName()
	    SDL_CDOpen()
	    SDL_CDStatus()
	    SDL_CDPlayTracks()
	    SDL_CDPlay()
	    SDL_CDPause()
	    SDL_CDResume()
	    SDL_CDStop()
	    SDL_CDEject()
	    SDL_CDClose()

0.9.4:
	No changes, bugfixes only.

0.9.3:
	Mouse motion event now includes relative motion information:
	    Sint16 event->motion.xrel, Sint16 event->motion.yrel

	X11 keyrepeat handling can be disabled by defining IGNORE_X_KEYREPEAT
	    (Add -DIGNORE_X_KEYREPEAT to CFLAGS line in obj/x11Makefile)

0.9.2:
	No changes, bugfixes only.

0.9.1:
	Removed SDL_MapSurface() and SDL_UnmapSurface() -- surfaces are now
	automatically mapped on blit.

0.8.0:
	SDL stable release

Added t2048/vendor/SDL-1.2.15/bin/SDL.dll.

cannot compute difference between binary files

Added t2048/vendor/SDL-1.2.15/bin/sdl-config.

























































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
#!/bin/sh

prefix=/usr/local/cross-tools/i686-w64-mingw32
exec_prefix=${prefix}
exec_prefix_set=no
libdir=${exec_prefix}/lib

usage="\
Usage: sdl-config [--prefix[=DIR]] [--exec-prefix[=DIR]] [--version] [--cflags] [--libs]"
#usage="\
#Usage: sdl-config [--prefix[=DIR]] [--exec-prefix[=DIR]] [--version] [--cflags] [--libs] [--static-libs]"

if test $# -eq 0; then
      echo "${usage}" 1>&2
      exit 1
fi

while test $# -gt 0; do
  case "$1" in
  -*=*) optarg=`echo "$1" | LC_ALL="C" sed 's/[-_a-zA-Z0-9]*=//'` ;;
  *) optarg= ;;
  esac

  case $1 in
    --prefix=*)
      prefix=$optarg
      if test $exec_prefix_set = no ; then
        exec_prefix=$optarg
      fi
      ;;
    --prefix)
      echo $prefix
      ;;
    --exec-prefix=*)
      exec_prefix=$optarg
      exec_prefix_set=yes
      ;;
    --exec-prefix)
      echo $exec_prefix
      ;;
    --version)
      echo 1.2.15
      ;;
    --cflags)
      echo -I${prefix}/include/SDL -D_GNU_SOURCE=1 -Dmain=SDL_main
      ;;
    --libs)
      echo -L${exec_prefix}/lib  -lmingw32 -lSDLmain -lSDL  -mwindows
      ;;
#    --static-libs)
##    --libs|--static-libs)
#      echo -L${exec_prefix}/lib  -lmingw32 -lSDLmain -lSDL  -mwindows  -lm -luser32 -lgdi32 -lwinmm -ldxguid
#      ;;
    *)
      echo "${usage}" 1>&2
      exit 1
      ;;
  esac
  shift
done

Added t2048/vendor/SDL-1.2.15/docs.html.





















































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
459
460
461
462
463
464
465
466
467
468
469
470
471
472
473
474
475
476
477
478
479
480
481
482
483
484
485
486
487
488
489
490
491
492
493
494
495
496
497
498
499
500
501
502
503
504
505
506
507
508
509
510
511
512
513
514
515
516
517
518
519
520
521
522
523
524
525
526
527
528
529
530
531
532
533
534
535
536
537
538
539
540
541
542
543
544
545
546
547
548
549
550
551
552
553
554
555
556
557
558
559
560
561
562
563
564
565
566
567
568
569
570
571
572
573
574
575
576
577
578
579
580
581
582
583
584
585
586
587
588
589
590
591
592
593
594
595
596
597
598
599
600
601
602
603
604
605
606
607
608
609
610
611
612
613
614
615
616
617
618
619
620
621
622
623
624
625
626
627
628
629
630
631
632
633
634
635
636
637
638
639
640
641
642
643
644
645
646
647
648
649
650
651
652
653
654
655
656
657
658
659
660
661
662
663
664
665
666
667
668
669
670
671
672
673
674
675
676
677
678
679
680
681
682
683
684
685
686
687
688
689
690
691
692
693
694
695
696
697
698
<HTML>
<HEAD><TITLE>SDL Stable Release</TITLE></HEAD>
<BODY BGCOLOR="#FFEBCD" TEXT="#000000">

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">
<P>
This source is stable, and is fully tested on all supported platforms.<br>
Please send bug reports or questions to the SDL mailing list:<br>
<a href="http://www.libsdl.org/mailing-list.php"
        >http://www.libsdl.org/mailing-list.php</a><br>
The latest stable release may be found on the
	<a href="http://www.libsdl.org/">SDL website</A>.
</P>

<H2> <A HREF="docs/index.html">API Documentation</A> </H2>

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">

<H2> SDL 1.2.15 Release Notes </H2>
<P>
SDL 1.2.15 is a minor bug fix release.
</P>

<H3> General Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed assembly register clobbering in CPU info routines
</P>
<P>
	Fixed memory stomp when using stretch blit on large images
</P>
<P>
	Fixed pixel corruption with overlapping blits
</P>
<P>
	SDL_JOYSTICK_DEVICE can be a colon separated list of joystick devices
</P>
<P>
	Disabled MMX blitters since they don't compile on modern compilers
</P>
</BLOCKQUOTE>

<H3> Unix Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed crash in joystick code on newer Linux kernels
</P>
<P>
	Fixed channel swizzling for ALSA target with 6-channel output
</P>
<P>
	Use the OpenGL GLX_EXT_swap_control extension if available
</P>
<P>
	XRandR support is disabled by default because it causes desktop reconfiguring.  It can be enabled with the SDL_VIDEO_X11_XRANDR=1 environment variable, or by applying this patch: <a href="http://hg.libsdl.org/SDL/raw-rev/8ec3036098df">http://hg.libsdl.org/SDL/raw-rev/8ec3036098df</a>
</P>
</BLOCKQUOTE>

<H3> Windows Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed SDL_GL_ACCELERATED_VISUAL handling
</P>
<P>
	Fixed application state handling with ALT-Tab
</P>
<P>
	Fixed occasional crash handling WM_ACTIVATEAPP in Direct X code
</P>
<P>
	Fixed UTF-8 decoding of Russian characters
</P>
</BLOCKQUOTE>

<H3> Mac OS X Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed building and running on Mac OS X 10.7 (Lion)
</P>
</BLOCKQUOTE>

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">

<H2> SDL 1.2.14 Release Notes </H2>
<P>
SDL 1.2.14 is a significant bug fix release and a recommended update.
</P>

<H3> General Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed flicker when resizing the SDL window
</P>
<P>
	Fixed crash in SDL_SetGammaRamp()
</P>
<P>
	Fixed freeze in SDL_memset() with 0 length when assembly code is disabled.
</P>
<P>
	Added SDL_DISABLE_LOCK_KEYS environment variable to enable normal up/down events for Caps-Lock and Num-Lock keys.
</P>
<P>
	Fixed audio quality problem when converting between 22050 Hz and 44100 Hz.
</P>
<P>
	Fixed a threading crash when a few threads are rapidly created and complete.
</P>
<P>
	Increased accuracy of alpha blending routines.
</P>
<P>
	Fixed crash loading BMP files saved with the scanlines inverted.
</P>
<P>
	Fixed mouse coordinate clamping if SDL_SetVideoMode() isn't called in response to SDL_VIDEORESIZE event.
</P>
<P>
	Added doxygen documentation for the SDL API headers.
</P>
</BLOCKQUOTE>

<H3> Unix Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed potential memory corruption due to assembly bug with SDL_revcpy()
</P>
<P>
	Fixed crashes trying to detect SSE features on x86_64 architecture.
</P>
<P>
	Fixed assembly for GCC optimized 50% alpha blending blits.
</P>
<P>
	Added configure option --enable-screensaver, to allow enabling the screensaver by default.
</P>
<P>
	Use XResetScreenSaver() instead of disabling screensaver entirely.
</P>
<P>
	Removed the maximum window size limitation on X11.
</P>
<P>
	Fixed SDL_GL_SWAP_CONTROL on X11.
</P>
<P>
	Fixed setting the X11 window input hint.
</P>
<P>
	Fixed distorted X11 window icon for some visuals.
</P>
<P>
	Fixed detecting X11 libraries for dynamic loading on 64-bit Linux.
</P>
<P>
	SDL_GL_GetAttribute(SDL_GL_SWAP_CONTROL) returns the correct value with GLX_SGI_swap_control.
</P>
<P>
	Added SDL_VIDEO_FULLSCREEN_DISPLAY as a preferred synonym for SDL_VIDEO_FULLSCREEN_HEAD on X11.
</P>
<P>
	The SDL_VIDEO_FULLSCREEN_DISPLAY environment variable can be set to 0 to place fullscreen SDL windows on the first Xinerama screen.
</P>
<P>
	Added the SDL_VIDEO_FBCON_ROTATION environment variable to control output orientation on the framebuffer console.
	<BR>
	Valid values are:
	<UL>
	<LI>not set   - Not rotating, no shadow.
	<LI>"NONE"    - Not rotating, but still using shadow.
	<LI>"CW"      - Rotating screen clockwise.
	<LI>"UD"      - Rotating screen upside down.
	<LI>"CCW"     - Rotating screen counter clockwise.
	</UL>
</P>
<P>
	Fixed DirectFB detection on some Linux distributions.
</P>
<P>
	Added code to use the PS3 SPE processors for YUV conversion on Linux.
</P>
<P>
	Updated ALSA support to the latest stable API
</P>
<P>
	ALSA is now preferred over OSS audio.  (SDL_AUDIODRIVER=dsp will restore the previous behavior.)
</P>
<P>
	Improved support for PulseAudio
</P>
<P>
	The Network Audio System support is now dynamically loaded at runtime.
</P>
<P>
	Fixed crash with the MP-8866 Dual USB Joypad on newer Linux kernels.
</P>
<P>
	Fixed crash in SDL_Quit() when a joystick has been unplugged.
</P>
</BLOCKQUOTE>

<H3> Windows Notes </H3>

<BLOCKQUOTE>
<P>
	Verified 100% compatibility with Windows 7.
</P>
<P>
	Prevent loss of OpenGL context when setting the video mode in response to a window resize event.
</P>
<P>
	Fixed video initialization with SDL_WINDOWID on Windows XP.
</P>
<P>
	Improved mouse input responsiveness for first-person-shooter games.
</P>
<P>
	IME messages are now generated for localized input.
</P>
<P>
	SDL_RWFromFile() takes a UTF-8 filename when opening a file.
</P>
<P>
	The SDL_STDIO_REDIRECT environment variable can be used to override whether SDL redirects stdio to stdout.txt and stderr.txt.
</P>
<P>
	Fixed dynamic object loading on Windows CE.
</P>
</BLOCKQUOTE>

<H3> Mac OS X Notes </H3>

<BLOCKQUOTE>
<P>
	SDL now builds on Mac OS X 10.6 (Snow Leopard).
	<BR>
	Eric Wing posted a good rundown on the numerous changes here: <A HREF="http://playcontrol.net/ewing/jibberjabber/big_behind-the-scenes_chang.html">http://playcontrol.net/ewing/jibberjabber/big_behind-the-scenes_chang.html</A>
</P>
<P>
	The X11 video driver is built by default.
</P>
<P>
	Fixed SDL_VIDEO_WINDOW_POS environment variable for Quartz target.
</P>
<P>
	Fixed setting the starting working directory in release builds.
</P>
</BLOCKQUOTE>

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">

<H2> SDL 1.2.13 Release Notes </H2>
<P>
SDL 1.2.13 is a minor bug fix release.
</P>

<H3> General Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed link error when building with Intel Compiler 10.
</P>
<P>
	Removed stray C++ comment from public headers.
</P>
</BLOCKQUOTE>

<H3> Unix Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed crash in SDL_SoftStretch() on secure operating systems.
</P>
<P>
	Fixed undefined symbol on X11 implementations without UTF-8 support.
</P>
<P>
	Worked around BadAlloc error when using XVideo on the XFree86 Intel Integrated Graphics driver.
</P>
<P>
	Scan for all joysticks on Linux instead of stopping at one that was removed.
</P>
<P>
	Fixed use of sdl-config arguments in sdl.m4
</P>
</BLOCKQUOTE>

<H3> Windows Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed crash when a video driver reports higher than 32 bpp video modes.
</P>
<P>
	Fixed restoring the desktop after setting a 24-bit OpenGL video mode.
</P>
<P>
	Fixed window titles on Windows 95/98/ME.
</P>
<P>
	Added SDL_BUTTON_X1 and SDL_BUTTON_X2 constants for extended mouse buttons.
</P>
<P>
	Added support for quoted command line arguments.
</P>
</BLOCKQUOTE>

<H3> Mac OS X Notes </H3>

<BLOCKQUOTE>
<P>
	SDL now builds on Mac OS X 10.5 (Leopard).
</P>
<P>
	Fixed high frequency crash involving text input.
</P>
<P>
	Fixed beeping when the escape key is pressed and UNICODE translation is enabled.
</P>
<P>
	Improved trackpad scrolling support.
</P>
<P>
	Fixed joystick hat reporting for certain joysticks.
</P>
</BLOCKQUOTE>

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">

<H2> SDL 1.2.12 Release Notes </H2>
<P>
SDL 1.2.12 is a minor bug fix release.
</P>

<H3> General Notes </H3>

<BLOCKQUOTE>
<P>
	Added support for the PulseAudio sound server: http://www.pulseaudio.org/
</P>
<P>
	Added SDL_VIDEO_ALLOW_SCREENSAVER to override SDL's disabling of the screensaver on Mac OS X, Windows, and X11.
</P>
<P>
	Fixed buffer overrun crash when resampling audio rates.
</P>
<P>
	Fixed audio bug where converting to mono was doubling the volume.
</P>
<P>
	Fixed off-by-one error in the C implementation of SDL_revcpy()
</P>
<P>
	Fixed compiling with Sun Studio.
</P>
<P>
	Support for AmigaOS has been removed from the main SDL code.
</P>
<P>
	Support for Nokia 9210 "EPOC" driver has been removed from the main SDL code.
</P>
<P>
	Unofficial support for the S60/SymbianOS platform has been added.
</P>
<P>
	Unofficial support for the Nintendo DS platform has been added.
</P>
<P>
	Reenabled MMX assembly for YUV overlay processing (GNU C Compiler only).
</P>
</BLOCKQUOTE>

<H3> Unix Notes </H3>

<BLOCKQUOTE>
<P>
	Fixed detection of X11 DGA mouse support.
</P>
<P>
	Improved XIM support for asian character sets.
</P>
<P>
	The GFX_Display has been added to the X11 window information in SDL_syswm.h.
</P>
<P>
	Fixed PAGE_SIZE compile error in the fbcon video driver on newer Linux kernels.
</P>
<P>
	Fixed hang or crash at startup if aRts can't access the hardware.
</P>
<P>
	Fixed relative mouse mode when the cursor starts outside the X11 window.
</P>
<P>
	Fixed accidental free of stack memory in X11 mouse acceleration code.
</P>
<P>
	Closed minor memory leak in XME code.
</P>
<P>
	Fixed TEXTRELs in the library to resolve some PIC issues.
</P>
</BLOCKQUOTE>

<H3> Windows Notes </H3>

<BLOCKQUOTE>
<P>
	The GDI video driver makes better use of the palette in 8-bit modes.
</P>
<P>
	The windib driver now supports more mouse buttons with WM_XBUTTON events.
</P>
<P>
	On Windows, SDL_SetVideoMode() will re-create the window instead of failing if the multisample settings are changed.
</P>
<P>
	Added support for UTF-8 window titles on Windows.
</P>
<P>
	Fixed joystick detection on Windows.
</P>
<P>
	Improved performance with Win32 file I/O.
</P>
<P>
	Fixed HBITMAP leak in GAPI driver.
</P>
</BLOCKQUOTE>

<H3> Mac OS X Notes </H3>

<BLOCKQUOTE>
<P>
	Added support for multi-axis controllers like 3Dconnxion's SpaceNavigator on Mac OS X.
</P>
<P>
	Fixed YUV overlay crash inside Quicktime on Intel Mac OS X.
</P>
<P>
	Fixed blitting alignment in Altivec alpha blit functions.
</P>
<P>
	Keys F13, F14, and F15 are now usable on Apple keyboards under Mac OS X.
</P>
<P>
	Fixed joystick calibration code on Mac OS X.
</P>
<P>
	Fixed mouse jitter when multiple motion events are queued up in Mac OS X.
</P>
<P>
	Fixed changing the cursor in fullscreen mode on Mac OS X.
</P>
</BLOCKQUOTE>

<H3> Mac OS Classic Notes </H3>

<BLOCKQUOTE>
<P>
	Added support for gamma ramps to both toolbox and DrawSprocket video drivers.
</P>
</BLOCKQUOTE>

<H3> BeOS Notes </H3>

<BLOCKQUOTE>
<P>
	Implemented mouse grabbing and mouse relative mode on BeOS.
</P>
</BLOCKQUOTE>

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">

<H2> SDL 1.2.11 Release Notes </H2>
<P>
SDL 1.2.11 is a minor bug fix release.
</P>

<H3> Unix Notes </H3>

<BLOCKQUOTE>
<P>
	Dynamic X11 loading is only enabled with gcc 4 supporting -fvisibility=hidden.  This fixes crashes related to symbol collisions, and allows building on Solaris and IRIX.
</P>
<P>
	Fixed building SDL with Xinerama disabled.
</P>
<P>
	Fixed DRI OpenGL library loading, using RTLD_GLOBAL in dlopen().
</P>
<P>
	Added pkgconfig configuration support.
</P>
</BLOCKQUOTE>

<H3> Windows Notes </H3>

<BLOCKQUOTE>
<P>
	Setting SDL_GL_SWAP_CONTROL now works with Windows OpenGL.
</P>
<P>
	The Win32 window positioning code works properly for windows with menus.
</P>
<P>
	DirectSound audio quality has been improved on certain sound cards.
</P>
<P>
	Fixed 5.1 audio channel ordering on Windows and Mac OS X.
</P>
<P>
	Plugged a couple of minor memory leaks in the windib video driver.
</P>
<P>
	Fixed type collision with stdint.h when building with gcc on Win32.
</P>
<P>
	Fixed building with the Digital Mars Compiler on Win32.
</P>
</BLOCKQUOTE>

<H3> Mac OS X Notes </H3>

<BLOCKQUOTE>
<P>
	The Quartz video driver supports 32x32 cursors on Mac OS X 10.3 and above.
</P>
</BLOCKQUOTE>

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">

<H2> SDL 1.2.10 Release Notes </H2>
<P>
SDL 1.2.10 is a major release, featuring a revamp of the build system and many API improvements and bug fixes.
</P>
<H3> API enhancements </H3>
<UL>
<LI>
	If SDL_OpenAudio() is passed zero for the desired format
	fields, the following environment variables will be used
	to fill them in:
<pre><code>
		SDL_AUDIO_FREQUENCY
		SDL_AUDIO_FORMAT
		SDL_AUDIO_CHANNELS
		SDL_AUDIO_SAMPLES
</code></pre>
	If an environment variable is not specified, it will be set
	to a reasonable default value.
<LI>
	SDL_SetVideoMode() now accepts 0 for width or height and will use
	the current video mode (or the desktop mode if no mode has been set.)
<LI>
	Added current_w and current_h to the SDL_VideoInfo structure,
	which is set to the desktop resolution during video intialization,
	and then set to the current resolution when a video mode is set.
<LI>
	SDL_GL_LoadLibrary() will load the system default OpenGL library
	if it is passed NULL as a parameter.
<LI>
	Added SDL_GL_SWAP_CONTROL to wait for vsync in OpenGL applications.
<LI>
	Added SDL_GL_ACCELERATED_VISUAL to guarantee hardware acceleration.
<LI>
	SDL_WM_SetCaption() now officially takes UTF-8 title and icon strings, and displays international characters on supported platforms.
<LI>
	Added SDL_GetKeyRepeat() to query the key repeat settings.
<LI>
	Added the "dummy" audio driver, which can be used to emulate audio
	output without a sound card.
<LI>
	Added SDL_config.h, with defaults for various build environments.
</UL>

<H3> General Notes </H3>

<BLOCKQUOTE>
<P>
	The SDL website now has an <A HREF="http://www.libsdl.org/rss/rss.xml">RSS feed</A>!
<P>
	The SDL development source code is now managed with <A HREF="http://www.libsdl.org/svn.php">Subversion</A>.
<P>
	SDL now uses the Bugzilla <A HREF="http://bugzilla.libsdl.org/">bug tracking system</A>, hosted by icculus.org.
<P>
	SDL is licensed under version 2.1 of the GNU Lesser General Public License.
<P>
	The entire build system has been revamped to make it much more portable, including versions of C library functions to make it possible to run SDL on a minimal embedded environment.  See README.Porting in the SDL source distribution for information on how to port SDL to a new platform.
<P>
	SDL_opengl.h has been updated with the latest glext.h from <A HREF="http://oss.sgi.com/projects/ogl-sample/registry/">http://oss.sgi.com/projects/ogl-sample/registry/</A>
<P>
	Alex Volkov contributed highly optimized RGB <-> RGBA blitters.
</BLOCKQUOTE>

<H3> Unix Notes </H3>

<BLOCKQUOTE>
<P>
	The X11 libraries are dynamically loaded at runtime by default.  This allows the distributed version of SDL to run on systems without X11 libraries installed.
<P>
	The XiG XME extension code is now included in the X11 video driver by default.
<P>
	XRandR support for video mode switching has been added to the X11 driver, but is disabled because of undesired interactions with window managers.  You can enable this by setting the environment variable SDL_VIDEO_X11_XRANDR to 1.
<P>
	Xinerama multi-head displays are properly handled now, and the SDL_VIDEO_FULLSCREEN_HEAD environment variable can be used to select the screen used for fullscreen video modes.  Note that changing the video modes only works on screen 0.
<P>
	XVidMode video modes are now sorted so they maintain the refresh rates specified in the X11 configuration file.
<P>
	SDL windows are no longer transparent in X11 compositing systems like XGL.
<P>
	The mouse is properly released by the X11 video driver if the fullscreen window loses focus.
<P>
	The X11 input driver now uses XIM to handle international input.
<P>
	The screensaver and DPMS monitor blanking are disabled while SDL games are running under the X11 and DGA video drivers.  This behavior will be formalized and selectable in SDL 1.3.
<P>
	Fixed a bug preventing stereo OpenGL contexts from being selected on the X11 driver.
<P>
	The DGA video driver now waits for pending blits involving surfaces before they are freed.  This prevents display oddities when using SDL_DisplayFormat() to convert many images.
<P>
	The framebuffer console video driver now has a parser for /etc/fb.modes for improved video mode handling.
<P>
	The framebuffer console video driver now allows asynchronous VT switching, and restores the full contents of the screen when switched back.
<P>
	The framebuffer console now uses CTRL-ALT-FN to switch virtual terminals, to avoid collisions with application key bindings.
<P>
	The framebuffer console input driver correctly sets IMPS/2 mode for wheel mice.  It also properly detects when gpm is in IMPS/2 protocol mode, or passing raw protocol from an IMPS/2 mouse.
<P>
	The SVGAlib video driver now has support for banked (non-linear) video modes.
<P>
	A video driver for OpenBSD on the Sharp Zaurus has been contributed by Staffan Ulfberg.  See the file README.wscons in the SDL source distribution for details.
<P>
	Many patches have been incorporated from *BSD ports.
</BLOCKQUOTE>

<H3> Windows Notes </H3>

<BLOCKQUOTE>
<P>
	The "windib" video driver is the default now, to prevent problems with certain laptops, 64-bit Windows, and Windows Vista.  The DirectX driver is still available, and can be selected by setting the environment variable SDL_VIDEODRIVER to "directx".
<P>
	SDL has been ported to 64-bit Windows.
<P>
	Dmitry Yakimov contributed a GAPI video driver for Windows CE.
<P>
	The default fullscreen refresh rate has been increased to match the desktop refresh rate, when using equivalent resolutions.  A full API for querying and selecting refresh rates is planned for SDL 1.3.
<P>
	Dialog boxes are now shown when SDL is in windowed OpenGL mode.
<P>
	The SDL window is recreated when necessary to maintain OpenGL context attributes, when switching between windowed and fullscreen modes.
<P>
	An SDL_VIDEORESIZE event is properly sent when the SDL window is maximized and restored.
<P>
	Window positions are retained when switching between fullscreen and windowed modes.
<P>
	ToUnicode() is used, when available, for improved handling of international keyboard input.
<P>
	The PrtScrn is now treated normally with both key down and key up events.
<P>
	Pressing ALT-F4 now delivers an SDL_QUIT event to SDL applications.
<P>
	Joystick names are now correct for joysticks which have been unplugged and then plugged back in since booting.
<P>
	An MCI error when playing the last track on a CD-ROM has been fixed.
<P>
	OpenWatcom projects for building SDL have been provided by Marc Peter.
</BLOCKQUOTE>

<H3> Mac OS X Notes </H3>

<BLOCKQUOTE>
<P>
	SDL now supports building Universal binaries, both through Xcode projects and when using configure/make.  See README.MacOSX in the SDL source archive for details.
<P>
	The X11 video driver with GLX support can be built on Mac OS X, if the X11 development SDK is installed.
<P>
	Transitions between fullscreen resolutions and windowed mode now use a much faster asynchronous fade to hide desktop flicker.
<P>
	Icons set with SDL_WM_SetIcon() now have the proper colors on Intel Macs.
</BLOCKQUOTE>

<H3> OS/2 Notes </H3>

<BLOCKQUOTE>
<P>
	Projects for building SDL on OS/2 with OpenWatcom have been contributed by Doodle.  See the file README.OS2 in the SDL source distribution for details.
</BLOCKQUOTE>

<IMG SRC="docs/images/rainbow.gif" ALT="[separator]" WIDTH="100%">

</BODY>
</HTML>

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL.h.











































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL.h
 *  Main include header for the SDL library
 */

#ifndef _SDL_H
#define _SDL_H

#include "SDL_main.h"
#include "SDL_stdinc.h"
#include "SDL_audio.h"
#include "SDL_cdrom.h"
#include "SDL_cpuinfo.h"
#include "SDL_endian.h"
#include "SDL_error.h"
#include "SDL_events.h"
#include "SDL_loadso.h"
#include "SDL_mutex.h"
#include "SDL_rwops.h"
#include "SDL_thread.h"
#include "SDL_timer.h"
#include "SDL_video.h"
#include "SDL_version.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** @file SDL.h
 *  @note As of version 0.5, SDL is loaded dynamically into the application
 */

/** @name SDL_INIT Flags
 *  These are the flags which may be passed to SDL_Init() -- you should
 *  specify the subsystems which you will be using in your application.
 */
/*@{*/
#define	SDL_INIT_TIMER		0x00000001
#define SDL_INIT_AUDIO		0x00000010
#define SDL_INIT_VIDEO		0x00000020
#define SDL_INIT_CDROM		0x00000100
#define SDL_INIT_JOYSTICK	0x00000200
#define SDL_INIT_NOPARACHUTE	0x00100000	/**< Don't catch fatal signals */
#define SDL_INIT_EVENTTHREAD	0x01000000	/**< Not supported on all OS's */
#define SDL_INIT_EVERYTHING	0x0000FFFF
/*@}*/

/** This function loads the SDL dynamically linked library and initializes 
 *  the subsystems specified by 'flags' (and those satisfying dependencies)
 *  Unless the SDL_INIT_NOPARACHUTE flag is set, it will install cleanup
 *  signal handlers for some commonly ignored fatal signals (like SIGSEGV)
 */
extern DECLSPEC int SDLCALL SDL_Init(Uint32 flags);

/** This function initializes specific SDL subsystems */
extern DECLSPEC int SDLCALL SDL_InitSubSystem(Uint32 flags);

/** This function cleans up specific SDL subsystems */
extern DECLSPEC void SDLCALL SDL_QuitSubSystem(Uint32 flags);

/** This function returns mask of the specified subsystems which have
 *  been initialized.
 *  If 'flags' is 0, it returns a mask of all initialized subsystems.
 */
extern DECLSPEC Uint32 SDLCALL SDL_WasInit(Uint32 flags);

/** This function cleans up all initialized subsystems and unloads the
 *  dynamically linked library.  You should call it upon all exit conditions.
 */
extern DECLSPEC void SDLCALL SDL_Quit(void);

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_H */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_active.h.































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_active.h
 *  Include file for SDL application focus event handling 
 */

#ifndef _SDL_active_h
#define _SDL_active_h

#include "SDL_stdinc.h"
#include "SDL_error.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** @name The available application states */
/*@{*/
#define SDL_APPMOUSEFOCUS	0x01		/**< The app has mouse coverage */
#define SDL_APPINPUTFOCUS	0x02		/**< The app has input focus */
#define SDL_APPACTIVE		0x04		/**< The application is active */
/*@}*/

/* Function prototypes */
/** 
 * This function returns the current state of the application, which is a
 * bitwise combination of SDL_APPMOUSEFOCUS, SDL_APPINPUTFOCUS, and
 * SDL_APPACTIVE.  If SDL_APPACTIVE is set, then the user is able to
 * see your application, otherwise it has been iconified or disabled.
 */
extern DECLSPEC Uint8 SDLCALL SDL_GetAppState(void);


/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_active_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_audio.h.

























































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_audio.h
 *  Access to the raw audio mixing buffer for the SDL library
 */

#ifndef _SDL_audio_h
#define _SDL_audio_h

#include "SDL_stdinc.h"
#include "SDL_error.h"
#include "SDL_endian.h"
#include "SDL_mutex.h"
#include "SDL_thread.h"
#include "SDL_rwops.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/**
 * When filling in the desired audio spec structure,
 * - 'desired->freq' should be the desired audio frequency in samples-per-second.
 * - 'desired->format' should be the desired audio format.
 * - 'desired->samples' is the desired size of the audio buffer, in samples.
 *     This number should be a power of two, and may be adjusted by the audio
 *     driver to a value more suitable for the hardware.  Good values seem to
 *     range between 512 and 8096 inclusive, depending on the application and
 *     CPU speed.  Smaller values yield faster response time, but can lead
 *     to underflow if the application is doing heavy processing and cannot
 *     fill the audio buffer in time.  A stereo sample consists of both right
 *     and left channels in LR ordering.
 *     Note that the number of samples is directly related to time by the
 *     following formula:  ms = (samples*1000)/freq
 * - 'desired->size' is the size in bytes of the audio buffer, and is
 *     calculated by SDL_OpenAudio().
 * - 'desired->silence' is the value used to set the buffer to silence,
 *     and is calculated by SDL_OpenAudio().
 * - 'desired->callback' should be set to a function that will be called
 *     when the audio device is ready for more data.  It is passed a pointer
 *     to the audio buffer, and the length in bytes of the audio buffer.
 *     This function usually runs in a separate thread, and so you should
 *     protect data structures that it accesses by calling SDL_LockAudio()
 *     and SDL_UnlockAudio() in your code.
 * - 'desired->userdata' is passed as the first parameter to your callback
 *     function.
 *
 * @note The calculated values in this structure are calculated by SDL_OpenAudio()
 *
 */
typedef struct SDL_AudioSpec {
	int freq;		/**< DSP frequency -- samples per second */
	Uint16 format;		/**< Audio data format */
	Uint8  channels;	/**< Number of channels: 1 mono, 2 stereo */
	Uint8  silence;		/**< Audio buffer silence value (calculated) */
	Uint16 samples;		/**< Audio buffer size in samples (power of 2) */
	Uint16 padding;		/**< Necessary for some compile environments */
	Uint32 size;		/**< Audio buffer size in bytes (calculated) */
	/**
	 *  This function is called when the audio device needs more data.
	 *
	 *  @param[out] stream	A pointer to the audio data buffer
	 *  @param[in]  len	The length of the audio buffer in bytes.
	 *
	 *  Once the callback returns, the buffer will no longer be valid.
	 *  Stereo samples are stored in a LRLRLR ordering.
	 */
	void (SDLCALL *callback)(void *userdata, Uint8 *stream, int len);
	void  *userdata;
} SDL_AudioSpec;

/**
 *  @name Audio format flags
 *  defaults to LSB byte order
 */
/*@{*/
#define AUDIO_U8	0x0008	/**< Unsigned 8-bit samples */
#define AUDIO_S8	0x8008	/**< Signed 8-bit samples */
#define AUDIO_U16LSB	0x0010	/**< Unsigned 16-bit samples */
#define AUDIO_S16LSB	0x8010	/**< Signed 16-bit samples */
#define AUDIO_U16MSB	0x1010	/**< As above, but big-endian byte order */
#define AUDIO_S16MSB	0x9010	/**< As above, but big-endian byte order */
#define AUDIO_U16	AUDIO_U16LSB
#define AUDIO_S16	AUDIO_S16LSB

/**
 *  @name Native audio byte ordering
 */
/*@{*/
#if SDL_BYTEORDER == SDL_LIL_ENDIAN
#define AUDIO_U16SYS	AUDIO_U16LSB
#define AUDIO_S16SYS	AUDIO_S16LSB
#else
#define AUDIO_U16SYS	AUDIO_U16MSB
#define AUDIO_S16SYS	AUDIO_S16MSB
#endif
/*@}*/

/*@}*/


/** A structure to hold a set of audio conversion filters and buffers */
typedef struct SDL_AudioCVT {
	int needed;			/**< Set to 1 if conversion possible */
	Uint16 src_format;		/**< Source audio format */
	Uint16 dst_format;		/**< Target audio format */
	double rate_incr;		/**< Rate conversion increment */
	Uint8 *buf;			/**< Buffer to hold entire audio data */
	int    len;			/**< Length of original audio buffer */
	int    len_cvt;			/**< Length of converted audio buffer */
	int    len_mult;		/**< buffer must be len*len_mult big */
	double len_ratio; 	/**< Given len, final size is len*len_ratio */
	void (SDLCALL *filters[10])(struct SDL_AudioCVT *cvt, Uint16 format);
	int filter_index;		/**< Current audio conversion function */
} SDL_AudioCVT;


/* Function prototypes */

/**
 * @name Audio Init and Quit
 * These functions are used internally, and should not be used unless you
 * have a specific need to specify the audio driver you want to use.
 * You should normally use SDL_Init() or SDL_InitSubSystem().
 */
/*@{*/
extern DECLSPEC int SDLCALL SDL_AudioInit(const char *driver_name);
extern DECLSPEC void SDLCALL SDL_AudioQuit(void);
/*@}*/

/**
 * This function fills the given character buffer with the name of the
 * current audio driver, and returns a pointer to it if the audio driver has
 * been initialized.  It returns NULL if no driver has been initialized.
 */
extern DECLSPEC char * SDLCALL SDL_AudioDriverName(char *namebuf, int maxlen);

/**
 * This function opens the audio device with the desired parameters, and
 * returns 0 if successful, placing the actual hardware parameters in the
 * structure pointed to by 'obtained'.  If 'obtained' is NULL, the audio
 * data passed to the callback function will be guaranteed to be in the
 * requested format, and will be automatically converted to the hardware
 * audio format if necessary.  This function returns -1 if it failed 
 * to open the audio device, or couldn't set up the audio thread.
 *
 * The audio device starts out playing silence when it's opened, and should
 * be enabled for playing by calling SDL_PauseAudio(0) when you are ready
 * for your audio callback function to be called.  Since the audio driver
 * may modify the requested size of the audio buffer, you should allocate
 * any local mixing buffers after you open the audio device.
 *
 * @sa SDL_AudioSpec
 */
extern DECLSPEC int SDLCALL SDL_OpenAudio(SDL_AudioSpec *desired, SDL_AudioSpec *obtained);

typedef enum {
	SDL_AUDIO_STOPPED = 0,
	SDL_AUDIO_PLAYING,
	SDL_AUDIO_PAUSED
} SDL_audiostatus;

/** Get the current audio state */
extern DECLSPEC SDL_audiostatus SDLCALL SDL_GetAudioStatus(void);

/**
 * This function pauses and unpauses the audio callback processing.
 * It should be called with a parameter of 0 after opening the audio
 * device to start playing sound.  This is so you can safely initialize
 * data for your callback function after opening the audio device.
 * Silence will be written to the audio device during the pause.
 */
extern DECLSPEC void SDLCALL SDL_PauseAudio(int pause_on);

/**
 * This function loads a WAVE from the data source, automatically freeing
 * that source if 'freesrc' is non-zero.  For example, to load a WAVE file,
 * you could do:
 *	@code SDL_LoadWAV_RW(SDL_RWFromFile("sample.wav", "rb"), 1, ...); @endcode
 *
 * If this function succeeds, it returns the given SDL_AudioSpec,
 * filled with the audio data format of the wave data, and sets
 * 'audio_buf' to a malloc()'d buffer containing the audio data,
 * and sets 'audio_len' to the length of that audio buffer, in bytes.
 * You need to free the audio buffer with SDL_FreeWAV() when you are 
 * done with it.
 *
 * This function returns NULL and sets the SDL error message if the 
 * wave file cannot be opened, uses an unknown data format, or is 
 * corrupt.  Currently raw and MS-ADPCM WAVE files are supported.
 */
extern DECLSPEC SDL_AudioSpec * SDLCALL SDL_LoadWAV_RW(SDL_RWops *src, int freesrc, SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len);

/** Compatibility convenience function -- loads a WAV from a file */
#define SDL_LoadWAV(file, spec, audio_buf, audio_len) \
	SDL_LoadWAV_RW(SDL_RWFromFile(file, "rb"),1, spec,audio_buf,audio_len)

/**
 * This function frees data previously allocated with SDL_LoadWAV_RW()
 */
extern DECLSPEC void SDLCALL SDL_FreeWAV(Uint8 *audio_buf);

/**
 * This function takes a source format and rate and a destination format
 * and rate, and initializes the 'cvt' structure with information needed
 * by SDL_ConvertAudio() to convert a buffer of audio data from one format
 * to the other.
 *
 * @return This function returns 0, or -1 if there was an error.
 */
extern DECLSPEC int SDLCALL SDL_BuildAudioCVT(SDL_AudioCVT *cvt,
		Uint16 src_format, Uint8 src_channels, int src_rate,
		Uint16 dst_format, Uint8 dst_channels, int dst_rate);

/**
 * Once you have initialized the 'cvt' structure using SDL_BuildAudioCVT(),
 * created an audio buffer cvt->buf, and filled it with cvt->len bytes of
 * audio data in the source format, this function will convert it in-place
 * to the desired format.
 * The data conversion may expand the size of the audio data, so the buffer
 * cvt->buf should be allocated after the cvt structure is initialized by
 * SDL_BuildAudioCVT(), and should be cvt->len*cvt->len_mult bytes long.
 */
extern DECLSPEC int SDLCALL SDL_ConvertAudio(SDL_AudioCVT *cvt);


#define SDL_MIX_MAXVOLUME 128
/**
 * This takes two audio buffers of the playing audio format and mixes
 * them, performing addition, volume adjustment, and overflow clipping.
 * The volume ranges from 0 - 128, and should be set to SDL_MIX_MAXVOLUME
 * for full audio volume.  Note this does not change hardware volume.
 * This is provided for convenience -- you can mix your own audio data.
 */
extern DECLSPEC void SDLCALL SDL_MixAudio(Uint8 *dst, const Uint8 *src, Uint32 len, int volume);

/**
 * @name Audio Locks
 * The lock manipulated by these functions protects the callback function.
 * During a LockAudio/UnlockAudio pair, you can be guaranteed that the
 * callback function is not running.  Do not call these from the callback
 * function or you will cause deadlock.
 */
/*@{*/
extern DECLSPEC void SDLCALL SDL_LockAudio(void);
extern DECLSPEC void SDLCALL SDL_UnlockAudio(void);
/*@}*/

/**
 * This function shuts down audio processing and closes the audio device.
 */
extern DECLSPEC void SDLCALL SDL_CloseAudio(void);


/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_audio_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_byteorder.h.



























































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_byteorder.h
 *  @deprecated Use SDL_endian.h instead
 */

/* DEPRECATED */
#include "SDL_endian.h"

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_cdrom.h.





















































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_cdrom.h
 *  This is the CD-audio control API for Simple DirectMedia Layer
 */

#ifndef _SDL_cdrom_h
#define _SDL_cdrom_h

#include "SDL_stdinc.h"
#include "SDL_error.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/**
 *  @file SDL_cdrom.h
 *  In order to use these functions, SDL_Init() must have been called
 *  with the SDL_INIT_CDROM flag.  This causes SDL to scan the system
 *  for CD-ROM drives, and load appropriate drivers.
 */

/** The maximum number of CD-ROM tracks on a disk */
#define SDL_MAX_TRACKS	99

/** @name Track Types
 *  The types of CD-ROM track possible
 */
/*@{*/
#define SDL_AUDIO_TRACK	0x00
#define SDL_DATA_TRACK	0x04
/*@}*/

/** The possible states which a CD-ROM drive can be in. */
typedef enum {
	CD_TRAYEMPTY,
	CD_STOPPED,
	CD_PLAYING,
	CD_PAUSED,
	CD_ERROR = -1
} CDstatus;

/** Given a status, returns true if there's a disk in the drive */
#define CD_INDRIVE(status)	((int)(status) > 0)

typedef struct SDL_CDtrack {
	Uint8 id;		/**< Track number */
	Uint8 type;		/**< Data or audio track */
	Uint16 unused;
	Uint32 length;		/**< Length, in frames, of this track */
	Uint32 offset;		/**< Offset, in frames, from start of disk */
} SDL_CDtrack;

/** This structure is only current as of the last call to SDL_CDStatus() */
typedef struct SDL_CD {
	int id;			/**< Private drive identifier */
	CDstatus status;	/**< Current drive status */

	/** The rest of this structure is only valid if there's a CD in drive */
        /*@{*/
	int numtracks;		/**< Number of tracks on disk */
	int cur_track;		/**< Current track position */
	int cur_frame;		/**< Current frame offset within current track */
	SDL_CDtrack track[SDL_MAX_TRACKS+1];
        /*@}*/
} SDL_CD;

/** @name Frames / MSF Conversion Functions
 *  Conversion functions from frames to Minute/Second/Frames and vice versa
 */
/*@{*/
#define CD_FPS	75
#define FRAMES_TO_MSF(f, M,S,F)	{					\
	int value = f;							\
	*(F) = value%CD_FPS;						\
	value /= CD_FPS;						\
	*(S) = value%60;						\
	value /= 60;							\
	*(M) = value;							\
}
#define MSF_TO_FRAMES(M, S, F)	((M)*60*CD_FPS+(S)*CD_FPS+(F))
/*@}*/

/* CD-audio API functions: */

/**
 *  Returns the number of CD-ROM drives on the system, or -1 if
 *  SDL_Init() has not been called with the SDL_INIT_CDROM flag.
 */
extern DECLSPEC int SDLCALL SDL_CDNumDrives(void);

/**
 *  Returns a human-readable, system-dependent identifier for the CD-ROM.
 *  Example:
 *   - "/dev/cdrom"
 *   - "E:"
 *   - "/dev/disk/ide/1/master"
 */
extern DECLSPEC const char * SDLCALL SDL_CDName(int drive);

/**
 *  Opens a CD-ROM drive for access.  It returns a drive handle on success,
 *  or NULL if the drive was invalid or busy.  This newly opened CD-ROM
 *  becomes the default CD used when other CD functions are passed a NULL
 *  CD-ROM handle.
 *  Drives are numbered starting with 0.  Drive 0 is the system default CD-ROM.
 */
extern DECLSPEC SDL_CD * SDLCALL SDL_CDOpen(int drive);

/**
 *  This function returns the current status of the given drive.
 *  If the drive has a CD in it, the table of contents of the CD and current
 *  play position of the CD will be stored in the SDL_CD structure.
 */
extern DECLSPEC CDstatus SDLCALL SDL_CDStatus(SDL_CD *cdrom);

/**
 *  Play the given CD starting at 'start_track' and 'start_frame' for 'ntracks'
 *  tracks and 'nframes' frames.  If both 'ntrack' and 'nframe' are 0, play 
 *  until the end of the CD.  This function will skip data tracks.
 *  This function should only be called after calling SDL_CDStatus() to 
 *  get track information about the CD.
 *  For example:
 *      @code
 *	// Play entire CD:
 *	if ( CD_INDRIVE(SDL_CDStatus(cdrom)) )
 *		SDL_CDPlayTracks(cdrom, 0, 0, 0, 0);
 *	// Play last track:
 *	if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) {
 *		SDL_CDPlayTracks(cdrom, cdrom->numtracks-1, 0, 0, 0);
 *	}
 *	// Play first and second track and 10 seconds of third track:
 *	if ( CD_INDRIVE(SDL_CDStatus(cdrom)) )
 *		SDL_CDPlayTracks(cdrom, 0, 0, 2, 10);
 *      @endcode
 *
 *  @return This function returns 0, or -1 if there was an error.
 */
extern DECLSPEC int SDLCALL SDL_CDPlayTracks(SDL_CD *cdrom,
		int start_track, int start_frame, int ntracks, int nframes);

/**
 *  Play the given CD starting at 'start' frame for 'length' frames.
 *  @return It returns 0, or -1 if there was an error.
 */
extern DECLSPEC int SDLCALL SDL_CDPlay(SDL_CD *cdrom, int start, int length);

/** Pause play
 *  @return returns 0, or -1 on error
 */
extern DECLSPEC int SDLCALL SDL_CDPause(SDL_CD *cdrom);

/** Resume play
 *  @return returns 0, or -1 on error
 */
extern DECLSPEC int SDLCALL SDL_CDResume(SDL_CD *cdrom);

/** Stop play
 *  @return returns 0, or -1 on error
 */
extern DECLSPEC int SDLCALL SDL_CDStop(SDL_CD *cdrom);

/** Eject CD-ROM
 *  @return returns 0, or -1 on error
 */
extern DECLSPEC int SDLCALL SDL_CDEject(SDL_CD *cdrom);

/** Closes the handle for the CD-ROM drive */
extern DECLSPEC void SDLCALL SDL_CDClose(SDL_CD *cdrom);


/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_video_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_config.h.



























































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

#ifndef _SDL_config_h
#define _SDL_config_h

#include "SDL_platform.h"

/* Add any platform that doesn't build using the configure system */
#if defined(__DREAMCAST__)
#include "SDL_config_dreamcast.h"
#elif defined(__MACOS__)
#include "SDL_config_macos.h"
#elif defined(__MACOSX__)
#include "SDL_config_macosx.h"
#elif defined(__SYMBIAN32__)
#include "SDL_config_symbian.h"  /* must be before win32! */
#elif defined(__WIN32__)
#include "SDL_config_win32.h"
#elif defined(__OS2__)
#include "SDL_config_os2.h"
#else
#include "SDL_config_minimal.h"
#endif /* platform config */

#endif /* _SDL_config_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_config_win32.h.















































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

#ifndef _SDL_config_win32_h
#define _SDL_config_win32_h

#include "SDL_platform.h"

/* This is a set of defines to configure the SDL features */

#if defined(__GNUC__) || defined(__DMC__)
#define HAVE_STDINT_H	1
#elif defined(_MSC_VER)
typedef signed __int8		int8_t;
typedef unsigned __int8		uint8_t;
typedef signed __int16		int16_t;
typedef unsigned __int16	uint16_t;
typedef signed __int32		int32_t;
typedef unsigned __int32	uint32_t;
typedef signed __int64		int64_t;
typedef unsigned __int64	uint64_t;
#ifndef _UINTPTR_T_DEFINED
#ifdef  _WIN64
typedef unsigned __int64    uintptr_t;
#else
typedef unsigned int   uintptr_t;
#endif
#define _UINTPTR_T_DEFINED
#endif
/* Older Visual C++ headers don't have the Win64-compatible typedefs... */
#if ((_MSC_VER <= 1200) && (!defined(DWORD_PTR)))
#define DWORD_PTR DWORD
#endif
#if ((_MSC_VER <= 1200) && (!defined(LONG_PTR)))
#define LONG_PTR LONG
#endif
#else	/* !__GNUC__ && !_MSC_VER */
typedef signed char int8_t;
typedef unsigned char uint8_t;
typedef signed short int16_t;
typedef unsigned short uint16_t;
typedef signed int int32_t;
typedef unsigned int uint32_t;
typedef signed long long int64_t;
typedef unsigned long long uint64_t;
#ifndef _SIZE_T_DEFINED_
#define _SIZE_T_DEFINED_
typedef unsigned int size_t;
#endif
typedef unsigned int uintptr_t;
#endif /* __GNUC__ || _MSC_VER */
#define SDL_HAS_64BIT_TYPE	1

/* Enabled for SDL 1.2 (binary compatibility) */
#define HAVE_LIBC	1
#ifdef HAVE_LIBC
/* Useful headers */
#define HAVE_STDIO_H 1
#define STDC_HEADERS 1
#define HAVE_STRING_H 1
#define HAVE_CTYPE_H 1
#define HAVE_MATH_H 1
#ifndef _WIN32_WCE
#define HAVE_SIGNAL_H 1
#endif

/* C library functions */
#define HAVE_MALLOC 1
#define HAVE_CALLOC 1
#define HAVE_REALLOC 1
#define HAVE_FREE 1
#define HAVE_ALLOCA 1
#define HAVE_QSORT 1
#define HAVE_ABS 1
#define HAVE_MEMSET 1
#define HAVE_MEMCPY 1
#define HAVE_MEMMOVE 1
#define HAVE_MEMCMP 1
#define HAVE_STRLEN 1
#define HAVE__STRREV 1
#define HAVE__STRUPR 1
#define HAVE__STRLWR 1
#define HAVE_STRCHR 1
#define HAVE_STRRCHR 1
#define HAVE_STRSTR 1
#define HAVE_ITOA 1
#define HAVE__LTOA 1
#define HAVE__ULTOA 1
#define HAVE_STRTOL 1
#define HAVE_STRTOUL 1
#define HAVE_STRTOLL 1
#define HAVE_STRTOD 1
#define HAVE_ATOI 1
#define HAVE_ATOF 1
#define HAVE_STRCMP 1
#define HAVE_STRNCMP 1
#define HAVE__STRICMP 1
#define HAVE__STRNICMP 1
#define HAVE_SSCANF 1
#else
#define HAVE_STDARG_H	1
#define HAVE_STDDEF_H	1
#endif

/* Enable various audio drivers */
#ifndef _WIN32_WCE
#define SDL_AUDIO_DRIVER_DSOUND	1
#endif
#define SDL_AUDIO_DRIVER_WAVEOUT	1
#define SDL_AUDIO_DRIVER_DISK	1
#define SDL_AUDIO_DRIVER_DUMMY	1

/* Enable various cdrom drivers */
#ifdef _WIN32_WCE
#define SDL_CDROM_DISABLED      1
#else
#define SDL_CDROM_WIN32		1
#endif

/* Enable various input drivers */
#ifdef _WIN32_WCE
#define SDL_JOYSTICK_DISABLED   1
#else
#define SDL_JOYSTICK_WINMM	1
#endif

/* Enable various shared object loading systems */
#define SDL_LOADSO_WIN32	1

/* Enable various threading systems */
#define SDL_THREAD_WIN32	1

/* Enable various timer systems */
#ifdef _WIN32_WCE
#define SDL_TIMER_WINCE	1
#else
#define SDL_TIMER_WIN32	1
#endif

/* Enable various video drivers */
#ifdef _WIN32_WCE
#define SDL_VIDEO_DRIVER_GAPI	1
#endif
#ifndef _WIN32_WCE
#define SDL_VIDEO_DRIVER_DDRAW	1
#endif
#define SDL_VIDEO_DRIVER_DUMMY	1
#define SDL_VIDEO_DRIVER_WINDIB	1

/* Enable OpenGL support */
#ifndef _WIN32_WCE
#define SDL_VIDEO_OPENGL	1
#define SDL_VIDEO_OPENGL_WGL	1
#endif

/* Disable screensaver */
#define SDL_VIDEO_DISABLE_SCREENSAVER	1

/* Enable assembly routines (Win64 doesn't have inline asm) */
#ifndef _WIN64
#define SDL_ASSEMBLY_ROUTINES	1
#endif

#endif /* _SDL_config_win32_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_copying.h.













































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2009 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_cpuinfo.h.











































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_cpuinfo.h
 *  CPU feature detection for SDL
 */

#ifndef _SDL_cpuinfo_h
#define _SDL_cpuinfo_h

#include "SDL_stdinc.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** This function returns true if the CPU has the RDTSC instruction */
extern DECLSPEC SDL_bool SDLCALL SDL_HasRDTSC(void);

/** This function returns true if the CPU has MMX features */
extern DECLSPEC SDL_bool SDLCALL SDL_HasMMX(void);

/** This function returns true if the CPU has MMX Ext. features */
extern DECLSPEC SDL_bool SDLCALL SDL_HasMMXExt(void);

/** This function returns true if the CPU has 3DNow features */
extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNow(void);

/** This function returns true if the CPU has 3DNow! Ext. features */
extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNowExt(void);

/** This function returns true if the CPU has SSE features */
extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE(void);

/** This function returns true if the CPU has SSE2 features */
extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE2(void);

/** This function returns true if the CPU has AltiVec features */
extern DECLSPEC SDL_bool SDLCALL SDL_HasAltiVec(void);

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_cpuinfo_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_endian.h.













































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_endian.h
 *  Functions for reading and writing endian-specific values
 */

#ifndef _SDL_endian_h
#define _SDL_endian_h

#include "SDL_stdinc.h"

/** @name SDL_ENDIANs
 *  The two types of endianness 
 */
/*@{*/
#define SDL_LIL_ENDIAN	1234
#define SDL_BIG_ENDIAN	4321
/*@}*/

#ifndef SDL_BYTEORDER	/* Not defined in SDL_config.h? */
#ifdef __linux__
#include <endian.h>
#define SDL_BYTEORDER  __BYTE_ORDER
#else /* __linux __ */
#if defined(__hppa__) || \
    defined(__m68k__) || defined(mc68000) || defined(_M_M68K) || \
    (defined(__MIPS__) && defined(__MISPEB__)) || \
    defined(__ppc__) || defined(__POWERPC__) || defined(_M_PPC) || \
    defined(__sparc__)
#define SDL_BYTEORDER	SDL_BIG_ENDIAN
#else
#define SDL_BYTEORDER	SDL_LIL_ENDIAN
#endif
#endif /* __linux __ */
#endif /* !SDL_BYTEORDER */


#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/**
 *  @name SDL_Swap Functions
 *  Use inline functions for compilers that support them, and static
 *  functions for those that do not.  Because these functions become
 *  static for compilers that do not support inline functions, this
 *  header should only be included in files that actually use them.
 */
/*@{*/
#if defined(__GNUC__) && defined(__i386__) && \
   !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */)
static __inline__ Uint16 SDL_Swap16(Uint16 x)
{
	__asm__("xchgb %b0,%h0" : "=q" (x) :  "0" (x));
	return x;
}
#elif defined(__GNUC__) && defined(__x86_64__)
static __inline__ Uint16 SDL_Swap16(Uint16 x)
{
	__asm__("xchgb %b0,%h0" : "=Q" (x) :  "0" (x));
	return x;
}
#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__))
static __inline__ Uint16 SDL_Swap16(Uint16 x)
{
	Uint16 result;

	__asm__("rlwimi %0,%2,8,16,23" : "=&r" (result) : "0" (x >> 8), "r" (x));
	return result;
}
#elif defined(__GNUC__) && (defined(__m68k__) && !defined(__mcoldfire__))
static __inline__ Uint16 SDL_Swap16(Uint16 x)
{
	__asm__("rorw #8,%0" : "=d" (x) :  "0" (x) : "cc");
	return x;
}
#else
static __inline__ Uint16 SDL_Swap16(Uint16 x) {
	return SDL_static_cast(Uint16, ((x<<8)|(x>>8)));
}
#endif

#if defined(__GNUC__) && defined(__i386__) && \
   !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */)
static __inline__ Uint32 SDL_Swap32(Uint32 x)
{
	__asm__("bswap %0" : "=r" (x) : "0" (x));
	return x;
}
#elif defined(__GNUC__) && defined(__x86_64__)
static __inline__ Uint32 SDL_Swap32(Uint32 x)
{
	__asm__("bswapl %0" : "=r" (x) : "0" (x));
	return x;
}
#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__))
static __inline__ Uint32 SDL_Swap32(Uint32 x)
{
	Uint32 result;

	__asm__("rlwimi %0,%2,24,16,23" : "=&r" (result) : "0" (x>>24), "r" (x));
	__asm__("rlwimi %0,%2,8,8,15"   : "=&r" (result) : "0" (result),    "r" (x));
	__asm__("rlwimi %0,%2,24,0,7"   : "=&r" (result) : "0" (result),    "r" (x));
	return result;
}
#elif defined(__GNUC__) && (defined(__m68k__) && !defined(__mcoldfire__))
static __inline__ Uint32 SDL_Swap32(Uint32 x)
{
	__asm__("rorw #8,%0\n\tswap %0\n\trorw #8,%0" : "=d" (x) :  "0" (x) : "cc");
	return x;
}
#else
static __inline__ Uint32 SDL_Swap32(Uint32 x) {
	return SDL_static_cast(Uint32, ((x<<24)|((x<<8)&0x00FF0000)|((x>>8)&0x0000FF00)|(x>>24)));
}
#endif

#ifdef SDL_HAS_64BIT_TYPE
#if defined(__GNUC__) && defined(__i386__) && \
   !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */)
static __inline__ Uint64 SDL_Swap64(Uint64 x)
{
	union { 
		struct { Uint32 a,b; } s;
		Uint64 u;
	} v;
	v.u = x;
	__asm__("bswapl %0 ; bswapl %1 ; xchgl %0,%1" 
	        : "=r" (v.s.a), "=r" (v.s.b) 
	        : "0" (v.s.a), "1" (v.s.b)); 
	return v.u;
}
#elif defined(__GNUC__) && defined(__x86_64__)
static __inline__ Uint64 SDL_Swap64(Uint64 x)
{
	__asm__("bswapq %0" : "=r" (x) : "0" (x));
	return x;
}
#else
static __inline__ Uint64 SDL_Swap64(Uint64 x)
{
	Uint32 hi, lo;

	/* Separate into high and low 32-bit values and swap them */
	lo = SDL_static_cast(Uint32, x & 0xFFFFFFFF);
	x >>= 32;
	hi = SDL_static_cast(Uint32, x & 0xFFFFFFFF);
	x = SDL_Swap32(lo);
	x <<= 32;
	x |= SDL_Swap32(hi);
	return (x);
}
#endif
#else
/* This is mainly to keep compilers from complaining in SDL code.
 * If there is no real 64-bit datatype, then compilers will complain about
 * the fake 64-bit datatype that SDL provides when it compiles user code.
 */
#define SDL_Swap64(X)	(X)
#endif /* SDL_HAS_64BIT_TYPE */
/*@}*/

/**
 *  @name SDL_SwapLE and SDL_SwapBE Functions
 *  Byteswap item from the specified endianness to the native endianness
 */
/*@{*/
#if SDL_BYTEORDER == SDL_LIL_ENDIAN
#define SDL_SwapLE16(X)	(X)
#define SDL_SwapLE32(X)	(X)
#define SDL_SwapLE64(X)	(X)
#define SDL_SwapBE16(X)	SDL_Swap16(X)
#define SDL_SwapBE32(X)	SDL_Swap32(X)
#define SDL_SwapBE64(X)	SDL_Swap64(X)
#else
#define SDL_SwapLE16(X)	SDL_Swap16(X)
#define SDL_SwapLE32(X)	SDL_Swap32(X)
#define SDL_SwapLE64(X)	SDL_Swap64(X)
#define SDL_SwapBE16(X)	(X)
#define SDL_SwapBE32(X)	(X)
#define SDL_SwapBE64(X)	(X)
#endif
/*@}*/

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_endian_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_error.h.

















































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_error.h
 *  Simple error message routines for SDL
 */

#ifndef _SDL_error_h
#define _SDL_error_h

#include "SDL_stdinc.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** 
 *  @name Public functions
 */
/*@{*/
extern DECLSPEC void SDLCALL SDL_SetError(const char *fmt, ...);
extern DECLSPEC char * SDLCALL SDL_GetError(void);
extern DECLSPEC void SDLCALL SDL_ClearError(void);
/*@}*/

/**
 *  @name Private functions
 *  @internal Private error message function - used internally
 */
/*@{*/
#define SDL_OutOfMemory()	SDL_Error(SDL_ENOMEM)
#define SDL_Unsupported()	SDL_Error(SDL_UNSUPPORTED)
typedef enum {
	SDL_ENOMEM,
	SDL_EFREAD,
	SDL_EFWRITE,
	SDL_EFSEEK,
	SDL_UNSUPPORTED,
	SDL_LASTERROR
} SDL_errorcode;
extern DECLSPEC void SDLCALL SDL_Error(SDL_errorcode code);
/*@}*/

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_error_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_events.h.









































































































































































































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/**
 *  @file SDL_events.h
 *  Include file for SDL event handling
 */

#ifndef _SDL_events_h
#define _SDL_events_h

#include "SDL_stdinc.h"
#include "SDL_error.h"
#include "SDL_active.h"
#include "SDL_keyboard.h"
#include "SDL_mouse.h"
#include "SDL_joystick.h"
#include "SDL_quit.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** @name General keyboard/mouse state definitions */
/*@{*/
#define SDL_RELEASED	0
#define SDL_PRESSED	1
/*@}*/

/** Event enumerations */
typedef enum {
       SDL_NOEVENT = 0,			/**< Unused (do not remove) */
       SDL_ACTIVEEVENT,			/**< Application loses/gains visibility */
       SDL_KEYDOWN,			/**< Keys pressed */
       SDL_KEYUP,			/**< Keys released */
       SDL_MOUSEMOTION,			/**< Mouse moved */
       SDL_MOUSEBUTTONDOWN,		/**< Mouse button pressed */
       SDL_MOUSEBUTTONUP,		/**< Mouse button released */
       SDL_JOYAXISMOTION,		/**< Joystick axis motion */
       SDL_JOYBALLMOTION,		/**< Joystick trackball motion */
       SDL_JOYHATMOTION,		/**< Joystick hat position change */
       SDL_JOYBUTTONDOWN,		/**< Joystick button pressed */
       SDL_JOYBUTTONUP,			/**< Joystick button released */
       SDL_QUIT,			/**< User-requested quit */
       SDL_SYSWMEVENT,			/**< System specific event */
       SDL_EVENT_RESERVEDA,		/**< Reserved for future use.. */
       SDL_EVENT_RESERVEDB,		/**< Reserved for future use.. */
       SDL_VIDEORESIZE,			/**< User resized video mode */
       SDL_VIDEOEXPOSE,			/**< Screen needs to be redrawn */
       SDL_EVENT_RESERVED2,		/**< Reserved for future use.. */
       SDL_EVENT_RESERVED3,		/**< Reserved for future use.. */
       SDL_EVENT_RESERVED4,		/**< Reserved for future use.. */
       SDL_EVENT_RESERVED5,		/**< Reserved for future use.. */
       SDL_EVENT_RESERVED6,		/**< Reserved for future use.. */
       SDL_EVENT_RESERVED7,		/**< Reserved for future use.. */
       /** Events SDL_USEREVENT through SDL_MAXEVENTS-1 are for your use */
       SDL_USEREVENT = 24,
       /** This last event is only for bounding internal arrays
	*  It is the number of bits in the event mask datatype -- Uint32
        */
       SDL_NUMEVENTS = 32
} SDL_EventType;

/** @name Predefined event masks */
/*@{*/
#define SDL_EVENTMASK(X)	(1<<(X))
typedef enum {
	SDL_ACTIVEEVENTMASK	= SDL_EVENTMASK(SDL_ACTIVEEVENT),
	SDL_KEYDOWNMASK		= SDL_EVENTMASK(SDL_KEYDOWN),
	SDL_KEYUPMASK		= SDL_EVENTMASK(SDL_KEYUP),
	SDL_KEYEVENTMASK	= SDL_EVENTMASK(SDL_KEYDOWN)|
	                          SDL_EVENTMASK(SDL_KEYUP),
	SDL_MOUSEMOTIONMASK	= SDL_EVENTMASK(SDL_MOUSEMOTION),
	SDL_MOUSEBUTTONDOWNMASK	= SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN),
	SDL_MOUSEBUTTONUPMASK	= SDL_EVENTMASK(SDL_MOUSEBUTTONUP),
	SDL_MOUSEEVENTMASK	= SDL_EVENTMASK(SDL_MOUSEMOTION)|
	                          SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN)|
	                          SDL_EVENTMASK(SDL_MOUSEBUTTONUP),
	SDL_JOYAXISMOTIONMASK	= SDL_EVENTMASK(SDL_JOYAXISMOTION),
	SDL_JOYBALLMOTIONMASK	= SDL_EVENTMASK(SDL_JOYBALLMOTION),
	SDL_JOYHATMOTIONMASK	= SDL_EVENTMASK(SDL_JOYHATMOTION),
	SDL_JOYBUTTONDOWNMASK	= SDL_EVENTMASK(SDL_JOYBUTTONDOWN),
	SDL_JOYBUTTONUPMASK	= SDL_EVENTMASK(SDL_JOYBUTTONUP),
	SDL_JOYEVENTMASK	= SDL_EVENTMASK(SDL_JOYAXISMOTION)|
	                          SDL_EVENTMASK(SDL_JOYBALLMOTION)|
	                          SDL_EVENTMASK(SDL_JOYHATMOTION)|
	                          SDL_EVENTMASK(SDL_JOYBUTTONDOWN)|
	                          SDL_EVENTMASK(SDL_JOYBUTTONUP),
	SDL_VIDEORESIZEMASK	= SDL_EVENTMASK(SDL_VIDEORESIZE),
	SDL_VIDEOEXPOSEMASK	= SDL_EVENTMASK(SDL_VIDEOEXPOSE),
	SDL_QUITMASK		= SDL_EVENTMASK(SDL_QUIT),
	SDL_SYSWMEVENTMASK	= SDL_EVENTMASK(SDL_SYSWMEVENT)
} SDL_EventMask ;
#define SDL_ALLEVENTS		0xFFFFFFFF
/*@}*/

/** Application visibility event structure */
typedef struct SDL_ActiveEvent {
	Uint8 type;	/**< SDL_ACTIVEEVENT */
	Uint8 gain;	/**< Whether given states were gained or lost (1/0) */
	Uint8 state;	/**< A mask of the focus states */
} SDL_ActiveEvent;

/** Keyboard event structure */
typedef struct SDL_KeyboardEvent {
	Uint8 type;	/**< SDL_KEYDOWN or SDL_KEYUP */
	Uint8 which;	/**< The keyboard device index */
	Uint8 state;	/**< SDL_PRESSED or SDL_RELEASED */
	SDL_keysym keysym;
} SDL_KeyboardEvent;

/** Mouse motion event structure */
typedef struct SDL_MouseMotionEvent {
	Uint8 type;	/**< SDL_MOUSEMOTION */
	Uint8 which;	/**< The mouse device index */
	Uint8 state;	/**< The current button state */
	Uint16 x, y;	/**< The X/Y coordinates of the mouse */
	Sint16 xrel;	/**< The relative motion in the X direction */
	Sint16 yrel;	/**< The relative motion in the Y direction */
} SDL_MouseMotionEvent;

/** Mouse button event structure */
typedef struct SDL_MouseButtonEvent {
	Uint8 type;	/**< SDL_MOUSEBUTTONDOWN or SDL_MOUSEBUTTONUP */
	Uint8 which;	/**< The mouse device index */
	Uint8 button;	/**< The mouse button index */
	Uint8 state;	/**< SDL_PRESSED or SDL_RELEASED */
	Uint16 x, y;	/**< The X/Y coordinates of the mouse at press time */
} SDL_MouseButtonEvent;

/** Joystick axis motion event structure */
typedef struct SDL_JoyAxisEvent {
	Uint8 type;	/**< SDL_JOYAXISMOTION */
	Uint8 which;	/**< The joystick device index */
	Uint8 axis;	/**< The joystick axis index */
	Sint16 value;	/**< The axis value (range: -32768 to 32767) */
} SDL_JoyAxisEvent;

/** Joystick trackball motion event structure */
typedef struct SDL_JoyBallEvent {
	Uint8 type;	/**< SDL_JOYBALLMOTION */
	Uint8 which;	/**< The joystick device index */
	Uint8 ball;	/**< The joystick trackball index */
	Sint16 xrel;	/**< The relative motion in the X direction */
	Sint16 yrel;	/**< The relative motion in the Y direction */
} SDL_JoyBallEvent;

/** Joystick hat position change event structure */
typedef struct SDL_JoyHatEvent {
	Uint8 type;	/**< SDL_JOYHATMOTION */
	Uint8 which;	/**< The joystick device index */
	Uint8 hat;	/**< The joystick hat index */
	Uint8 value;	/**< The hat position value:
			 *   SDL_HAT_LEFTUP   SDL_HAT_UP       SDL_HAT_RIGHTUP
			 *   SDL_HAT_LEFT     SDL_HAT_CENTERED SDL_HAT_RIGHT
			 *   SDL_HAT_LEFTDOWN SDL_HAT_DOWN     SDL_HAT_RIGHTDOWN
			 *  Note that zero means the POV is centered.
			 */
} SDL_JoyHatEvent;

/** Joystick button event structure */
typedef struct SDL_JoyButtonEvent {
	Uint8 type;	/**< SDL_JOYBUTTONDOWN or SDL_JOYBUTTONUP */
	Uint8 which;	/**< The joystick device index */
	Uint8 button;	/**< The joystick button index */
	Uint8 state;	/**< SDL_PRESSED or SDL_RELEASED */
} SDL_JoyButtonEvent;

/** The "window resized" event
 *  When you get this event, you are responsible for setting a new video
 *  mode with the new width and height.
 */
typedef struct SDL_ResizeEvent {
	Uint8 type;	/**< SDL_VIDEORESIZE */
	int w;		/**< New width */
	int h;		/**< New height */
} SDL_ResizeEvent;

/** The "screen redraw" event */
typedef struct SDL_ExposeEvent {
	Uint8 type;	/**< SDL_VIDEOEXPOSE */
} SDL_ExposeEvent;

/** The "quit requested" event */
typedef struct SDL_QuitEvent {
	Uint8 type;	/**< SDL_QUIT */
} SDL_QuitEvent;

/** A user-defined event type */
typedef struct SDL_UserEvent {
	Uint8 type;	/**< SDL_USEREVENT through SDL_NUMEVENTS-1 */
	int code;	/**< User defined event code */
	void *data1;	/**< User defined data pointer */
	void *data2;	/**< User defined data pointer */
} SDL_UserEvent;

/** If you want to use this event, you should include SDL_syswm.h */
struct SDL_SysWMmsg;
typedef struct SDL_SysWMmsg SDL_SysWMmsg;
typedef struct SDL_SysWMEvent {
	Uint8 type;
	SDL_SysWMmsg *msg;
} SDL_SysWMEvent;

/** General event structure */
typedef union SDL_Event {
	Uint8 type;
	SDL_ActiveEvent active;
	SDL_KeyboardEvent key;
	SDL_MouseMotionEvent motion;
	SDL_MouseButtonEvent button;
	SDL_JoyAxisEvent jaxis;
	SDL_JoyBallEvent jball;
	SDL_JoyHatEvent jhat;
	SDL_JoyButtonEvent jbutton;
	SDL_ResizeEvent resize;
	SDL_ExposeEvent expose;
	SDL_QuitEvent quit;
	SDL_UserEvent user;
	SDL_SysWMEvent syswm;
} SDL_Event;


/* Function prototypes */

/** Pumps the event loop, gathering events from the input devices.
 *  This function updates the event queue and internal input device state.
 *  This should only be run in the thread that sets the video mode.
 */
extern DECLSPEC void SDLCALL SDL_PumpEvents(void);

typedef enum {
	SDL_ADDEVENT,
	SDL_PEEKEVENT,
	SDL_GETEVENT
} SDL_eventaction;

/**
 *  Checks the event queue for messages and optionally returns them.
 *
 *  If 'action' is SDL_ADDEVENT, up to 'numevents' events will be added to
 *  the back of the event queue.
 *  If 'action' is SDL_PEEKEVENT, up to 'numevents' events at the front
 *  of the event queue, matching 'mask', will be returned and will not
 *  be removed from the queue.
 *  If 'action' is SDL_GETEVENT, up to 'numevents' events at the front 
 *  of the event queue, matching 'mask', will be returned and will be
 *  removed from the queue.
 *
 *  @return
 *  This function returns the number of events actually stored, or -1
 *  if there was an error.
 *
 *  This function is thread-safe.
 */
extern DECLSPEC int SDLCALL SDL_PeepEvents(SDL_Event *events, int numevents,
				SDL_eventaction action, Uint32 mask);

/** Polls for currently pending events, and returns 1 if there are any pending
 *  events, or 0 if there are none available.  If 'event' is not NULL, the next
 *  event is removed from the queue and stored in that area.
 */
extern DECLSPEC int SDLCALL SDL_PollEvent(SDL_Event *event);

/** Waits indefinitely for the next available event, returning 1, or 0 if there
 *  was an error while waiting for events.  If 'event' is not NULL, the next
 *  event is removed from the queue and stored in that area.
 */
extern DECLSPEC int SDLCALL SDL_WaitEvent(SDL_Event *event);

/** Add an event to the event queue.
 *  This function returns 0 on success, or -1 if the event queue was full
 *  or there was some other error.
 */
extern DECLSPEC int SDLCALL SDL_PushEvent(SDL_Event *event);

/** @name Event Filtering */
/*@{*/
typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event);
/**
 *  This function sets up a filter to process all events before they
 *  change internal state and are posted to the internal event queue.
 *
 *  The filter is protypted as:
 *      @code typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event); @endcode
 *
 * If the filter returns 1, then the event will be added to the internal queue.
 * If it returns 0, then the event will be dropped from the queue, but the 
 * internal state will still be updated.  This allows selective filtering of
 * dynamically arriving events.
 *
 * @warning  Be very careful of what you do in the event filter function, as 
 *           it may run in a different thread!
 *
 * There is one caveat when dealing with the SDL_QUITEVENT event type.  The
 * event filter is only called when the window manager desires to close the
 * application window.  If the event filter returns 1, then the window will
 * be closed, otherwise the window will remain open if possible.
 * If the quit event is generated by an interrupt signal, it will bypass the
 * internal queue and be delivered to the application at the next event poll.
 */
extern DECLSPEC void SDLCALL SDL_SetEventFilter(SDL_EventFilter filter);

/**
 *  Return the current event filter - can be used to "chain" filters.
 *  If there is no event filter set, this function returns NULL.
 */
extern DECLSPEC SDL_EventFilter SDLCALL SDL_GetEventFilter(void);
/*@}*/

/** @name Event State */
/*@{*/
#define SDL_QUERY	-1
#define SDL_IGNORE	 0
#define SDL_DISABLE	 0
#define SDL_ENABLE	 1
/*@}*/

/**
* This function allows you to set the state of processing certain events.
* If 'state' is set to SDL_IGNORE, that event will be automatically dropped
* from the event queue and will not event be filtered.
* If 'state' is set to SDL_ENABLE, that event will be processed normally.
* If 'state' is set to SDL_QUERY, SDL_EventState() will return the 
* current processing state of the specified event.
*/
extern DECLSPEC Uint8 SDLCALL SDL_EventState(Uint8 type, int state);

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_events_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_getenv.h.

























































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_getenv.h
 *  @deprecated Use SDL_stdinc.h instead
 */

/* DEPRECATED */
#include "SDL_stdinc.h"

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_joystick.h.























































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_joystick.h
 *  Include file for SDL joystick event handling
 */

#ifndef _SDL_joystick_h
#define _SDL_joystick_h

#include "SDL_stdinc.h"
#include "SDL_error.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** @file SDL_joystick.h
 *  @note In order to use these functions, SDL_Init() must have been called
 *        with the SDL_INIT_JOYSTICK flag.  This causes SDL to scan the system
 *        for joysticks, and load appropriate drivers.
 */

/** The joystick structure used to identify an SDL joystick */
struct _SDL_Joystick;
typedef struct _SDL_Joystick SDL_Joystick;

/* Function prototypes */
/**
 * Count the number of joysticks attached to the system
 */
extern DECLSPEC int SDLCALL SDL_NumJoysticks(void);

/**
 * Get the implementation dependent name of a joystick.
 *
 * This can be called before any joysticks are opened.
 * If no name can be found, this function returns NULL.
 */
extern DECLSPEC const char * SDLCALL SDL_JoystickName(int device_index);

/**
 * Open a joystick for use.
 *
 * @param[in] device_index
 * The index passed as an argument refers to
 * the N'th joystick on the system.  This index is the value which will
 * identify this joystick in future joystick events.
 *
 * @return This function returns a joystick identifier, or NULL if an error occurred.
 */
extern DECLSPEC SDL_Joystick * SDLCALL SDL_JoystickOpen(int device_index);

/**
 * Returns 1 if the joystick has been opened, or 0 if it has not.
 */
extern DECLSPEC int SDLCALL SDL_JoystickOpened(int device_index);

/**
 * Get the device index of an opened joystick.
 */
extern DECLSPEC int SDLCALL SDL_JoystickIndex(SDL_Joystick *joystick);

/**
 * Get the number of general axis controls on a joystick
 */
extern DECLSPEC int SDLCALL SDL_JoystickNumAxes(SDL_Joystick *joystick);

/**
 * Get the number of trackballs on a joystick
 *
 * Joystick trackballs have only relative motion events associated
 * with them and their state cannot be polled.
 */
extern DECLSPEC int SDLCALL SDL_JoystickNumBalls(SDL_Joystick *joystick);

/**
 * Get the number of POV hats on a joystick
 */
extern DECLSPEC int SDLCALL SDL_JoystickNumHats(SDL_Joystick *joystick);

/**
 * Get the number of buttons on a joystick
 */
extern DECLSPEC int SDLCALL SDL_JoystickNumButtons(SDL_Joystick *joystick);

/**
 * Update the current state of the open joysticks.
 *
 * This is called automatically by the event loop if any joystick
 * events are enabled.
 */
extern DECLSPEC void SDLCALL SDL_JoystickUpdate(void);

/**
 * Enable/disable joystick event polling.
 *
 * If joystick events are disabled, you must call SDL_JoystickUpdate()
 * yourself and check the state of the joystick when you want joystick
 * information.
 *
 * @param[in] state The state can be one of SDL_QUERY, SDL_ENABLE or SDL_IGNORE.
 */
extern DECLSPEC int SDLCALL SDL_JoystickEventState(int state);

/**
 * Get the current state of an axis control on a joystick
 *
 * @param[in] axis The axis indices start at index 0.
 *
 * @return The state is a value ranging from -32768 to 32767.
 */
extern DECLSPEC Sint16 SDLCALL SDL_JoystickGetAxis(SDL_Joystick *joystick, int axis);

/**
 *  @name Hat Positions
 *  The return value of SDL_JoystickGetHat() is one of the following positions:
 */
/*@{*/
#define SDL_HAT_CENTERED	0x00
#define SDL_HAT_UP		0x01
#define SDL_HAT_RIGHT		0x02
#define SDL_HAT_DOWN		0x04
#define SDL_HAT_LEFT		0x08
#define SDL_HAT_RIGHTUP		(SDL_HAT_RIGHT|SDL_HAT_UP)
#define SDL_HAT_RIGHTDOWN	(SDL_HAT_RIGHT|SDL_HAT_DOWN)
#define SDL_HAT_LEFTUP		(SDL_HAT_LEFT|SDL_HAT_UP)
#define SDL_HAT_LEFTDOWN	(SDL_HAT_LEFT|SDL_HAT_DOWN)
/*@}*/

/** 
 *  Get the current state of a POV hat on a joystick
 *
 *  @param[in] hat The hat indices start at index 0.
 */
extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetHat(SDL_Joystick *joystick, int hat);

/**
 * Get the ball axis change since the last poll
 *
 * @param[in] ball The ball indices start at index 0.
 *
 * @return This returns 0, or -1 if you passed it invalid parameters.
 */
extern DECLSPEC int SDLCALL SDL_JoystickGetBall(SDL_Joystick *joystick, int ball, int *dx, int *dy);

/**
 * Get the current state of a button on a joystick
 *
 * @param[in] button The button indices start at index 0.
 */
extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetButton(SDL_Joystick *joystick, int button);

/**
 * Close a joystick previously opened with SDL_JoystickOpen()
 */
extern DECLSPEC void SDLCALL SDL_JoystickClose(SDL_Joystick *joystick);


/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_joystick_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_keyboard.h.















































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_keyboard.h
 *  Include file for SDL keyboard event handling
 */

#ifndef _SDL_keyboard_h
#define _SDL_keyboard_h

#include "SDL_stdinc.h"
#include "SDL_error.h"
#include "SDL_keysym.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** Keysym structure
 *
 *  - The scancode is hardware dependent, and should not be used by general
 *    applications.  If no hardware scancode is available, it will be 0.
 *
 *  - The 'unicode' translated character is only available when character
 *    translation is enabled by the SDL_EnableUNICODE() API.  If non-zero,
 *    this is a UNICODE character corresponding to the keypress.  If the
 *    high 9 bits of the character are 0, then this maps to the equivalent
 *    ASCII character:
 *      @code
 *	char ch;
 *	if ( (keysym.unicode & 0xFF80) == 0 ) {
 *		ch = keysym.unicode & 0x7F;
 *	} else {
 *		An international character..
 *	}
 *      @endcode
 */
typedef struct SDL_keysym {
	Uint8 scancode;			/**< hardware specific scancode */
	SDLKey sym;			/**< SDL virtual keysym */
	SDLMod mod;			/**< current key modifiers */
	Uint16 unicode;			/**< translated character */
} SDL_keysym;

/** This is the mask which refers to all hotkey bindings */
#define SDL_ALL_HOTKEYS		0xFFFFFFFF

/* Function prototypes */
/**
 * Enable/Disable UNICODE translation of keyboard input.
 *
 * This translation has some overhead, so translation defaults off.
 *
 * @param[in] enable
 * If 'enable' is 1, translation is enabled.
 * If 'enable' is 0, translation is disabled.
 * If 'enable' is -1, the translation state is not changed.
 *
 * @return It returns the previous state of keyboard translation.
 */
extern DECLSPEC int SDLCALL SDL_EnableUNICODE(int enable);

#define SDL_DEFAULT_REPEAT_DELAY	500
#define SDL_DEFAULT_REPEAT_INTERVAL	30
/**
 * Enable/Disable keyboard repeat.  Keyboard repeat defaults to off.
 *
 *  @param[in] delay
 *  'delay' is the initial delay in ms between the time when a key is
 *  pressed, and keyboard repeat begins.
 *
 *  @param[in] interval
 *  'interval' is the time in ms between keyboard repeat events.
 *
 *  If 'delay' is set to 0, keyboard repeat is disabled.
 */
extern DECLSPEC int SDLCALL SDL_EnableKeyRepeat(int delay, int interval);
extern DECLSPEC void SDLCALL SDL_GetKeyRepeat(int *delay, int *interval);

/**
 * Get a snapshot of the current state of the keyboard.
 * Returns an array of keystates, indexed by the SDLK_* syms.
 * Usage:
 *	@code
 * 	Uint8 *keystate = SDL_GetKeyState(NULL);
 *	if ( keystate[SDLK_RETURN] ) //... \<RETURN> is pressed.
 *	@endcode
 */
extern DECLSPEC Uint8 * SDLCALL SDL_GetKeyState(int *numkeys);

/**
 * Get the current key modifier state
 */
extern DECLSPEC SDLMod SDLCALL SDL_GetModState(void);

/**
 * Set the current key modifier state.
 * This does not change the keyboard state, only the key modifier flags.
 */
extern DECLSPEC void SDLCALL SDL_SetModState(SDLMod modstate);

/**
 * Get the name of an SDL virtual keysym
 */
extern DECLSPEC char * SDLCALL SDL_GetKeyName(SDLKey key);


/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_keyboard_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_keysym.h.













































































































































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

#ifndef _SDL_keysym_h
#define _SDL_keysym_h

/** What we really want is a mapping of every raw key on the keyboard.
 *  To support international keyboards, we use the range 0xA1 - 0xFF
 *  as international virtual keycodes.  We'll follow in the footsteps of X11...
 *  @brief The names of the keys
 */
typedef enum {
        /** @name ASCII mapped keysyms
         *  The keyboard syms have been cleverly chosen to map to ASCII
         */
        /*@{*/
	SDLK_UNKNOWN		= 0,
	SDLK_FIRST		= 0,
	SDLK_BACKSPACE		= 8,
	SDLK_TAB		= 9,
	SDLK_CLEAR		= 12,
	SDLK_RETURN		= 13,
	SDLK_PAUSE		= 19,
	SDLK_ESCAPE		= 27,
	SDLK_SPACE		= 32,
	SDLK_EXCLAIM		= 33,
	SDLK_QUOTEDBL		= 34,
	SDLK_HASH		= 35,
	SDLK_DOLLAR		= 36,
	SDLK_AMPERSAND		= 38,
	SDLK_QUOTE		= 39,
	SDLK_LEFTPAREN		= 40,
	SDLK_RIGHTPAREN		= 41,
	SDLK_ASTERISK		= 42,
	SDLK_PLUS		= 43,
	SDLK_COMMA		= 44,
	SDLK_MINUS		= 45,
	SDLK_PERIOD		= 46,
	SDLK_SLASH		= 47,
	SDLK_0			= 48,
	SDLK_1			= 49,
	SDLK_2			= 50,
	SDLK_3			= 51,
	SDLK_4			= 52,
	SDLK_5			= 53,
	SDLK_6			= 54,
	SDLK_7			= 55,
	SDLK_8			= 56,
	SDLK_9			= 57,
	SDLK_COLON		= 58,
	SDLK_SEMICOLON		= 59,
	SDLK_LESS		= 60,
	SDLK_EQUALS		= 61,
	SDLK_GREATER		= 62,
	SDLK_QUESTION		= 63,
	SDLK_AT			= 64,
	/* 
	   Skip uppercase letters
	 */
	SDLK_LEFTBRACKET	= 91,
	SDLK_BACKSLASH		= 92,
	SDLK_RIGHTBRACKET	= 93,
	SDLK_CARET		= 94,
	SDLK_UNDERSCORE		= 95,
	SDLK_BACKQUOTE		= 96,
	SDLK_a			= 97,
	SDLK_b			= 98,
	SDLK_c			= 99,
	SDLK_d			= 100,
	SDLK_e			= 101,
	SDLK_f			= 102,
	SDLK_g			= 103,
	SDLK_h			= 104,
	SDLK_i			= 105,
	SDLK_j			= 106,
	SDLK_k			= 107,
	SDLK_l			= 108,
	SDLK_m			= 109,
	SDLK_n			= 110,
	SDLK_o			= 111,
	SDLK_p			= 112,
	SDLK_q			= 113,
	SDLK_r			= 114,
	SDLK_s			= 115,
	SDLK_t			= 116,
	SDLK_u			= 117,
	SDLK_v			= 118,
	SDLK_w			= 119,
	SDLK_x			= 120,
	SDLK_y			= 121,
	SDLK_z			= 122,
	SDLK_DELETE		= 127,
	/* End of ASCII mapped keysyms */
        /*@}*/

	/** @name International keyboard syms */
        /*@{*/
	SDLK_WORLD_0		= 160,		/* 0xA0 */
	SDLK_WORLD_1		= 161,
	SDLK_WORLD_2		= 162,
	SDLK_WORLD_3		= 163,
	SDLK_WORLD_4		= 164,
	SDLK_WORLD_5		= 165,
	SDLK_WORLD_6		= 166,
	SDLK_WORLD_7		= 167,
	SDLK_WORLD_8		= 168,
	SDLK_WORLD_9		= 169,
	SDLK_WORLD_10		= 170,
	SDLK_WORLD_11		= 171,
	SDLK_WORLD_12		= 172,
	SDLK_WORLD_13		= 173,
	SDLK_WORLD_14		= 174,
	SDLK_WORLD_15		= 175,
	SDLK_WORLD_16		= 176,
	SDLK_WORLD_17		= 177,
	SDLK_WORLD_18		= 178,
	SDLK_WORLD_19		= 179,
	SDLK_WORLD_20		= 180,
	SDLK_WORLD_21		= 181,
	SDLK_WORLD_22		= 182,
	SDLK_WORLD_23		= 183,
	SDLK_WORLD_24		= 184,
	SDLK_WORLD_25		= 185,
	SDLK_WORLD_26		= 186,
	SDLK_WORLD_27		= 187,
	SDLK_WORLD_28		= 188,
	SDLK_WORLD_29		= 189,
	SDLK_WORLD_30		= 190,
	SDLK_WORLD_31		= 191,
	SDLK_WORLD_32		= 192,
	SDLK_WORLD_33		= 193,
	SDLK_WORLD_34		= 194,
	SDLK_WORLD_35		= 195,
	SDLK_WORLD_36		= 196,
	SDLK_WORLD_37		= 197,
	SDLK_WORLD_38		= 198,
	SDLK_WORLD_39		= 199,
	SDLK_WORLD_40		= 200,
	SDLK_WORLD_41		= 201,
	SDLK_WORLD_42		= 202,
	SDLK_WORLD_43		= 203,
	SDLK_WORLD_44		= 204,
	SDLK_WORLD_45		= 205,
	SDLK_WORLD_46		= 206,
	SDLK_WORLD_47		= 207,
	SDLK_WORLD_48		= 208,
	SDLK_WORLD_49		= 209,
	SDLK_WORLD_50		= 210,
	SDLK_WORLD_51		= 211,
	SDLK_WORLD_52		= 212,
	SDLK_WORLD_53		= 213,
	SDLK_WORLD_54		= 214,
	SDLK_WORLD_55		= 215,
	SDLK_WORLD_56		= 216,
	SDLK_WORLD_57		= 217,
	SDLK_WORLD_58		= 218,
	SDLK_WORLD_59		= 219,
	SDLK_WORLD_60		= 220,
	SDLK_WORLD_61		= 221,
	SDLK_WORLD_62		= 222,
	SDLK_WORLD_63		= 223,
	SDLK_WORLD_64		= 224,
	SDLK_WORLD_65		= 225,
	SDLK_WORLD_66		= 226,
	SDLK_WORLD_67		= 227,
	SDLK_WORLD_68		= 228,
	SDLK_WORLD_69		= 229,
	SDLK_WORLD_70		= 230,
	SDLK_WORLD_71		= 231,
	SDLK_WORLD_72		= 232,
	SDLK_WORLD_73		= 233,
	SDLK_WORLD_74		= 234,
	SDLK_WORLD_75		= 235,
	SDLK_WORLD_76		= 236,
	SDLK_WORLD_77		= 237,
	SDLK_WORLD_78		= 238,
	SDLK_WORLD_79		= 239,
	SDLK_WORLD_80		= 240,
	SDLK_WORLD_81		= 241,
	SDLK_WORLD_82		= 242,
	SDLK_WORLD_83		= 243,
	SDLK_WORLD_84		= 244,
	SDLK_WORLD_85		= 245,
	SDLK_WORLD_86		= 246,
	SDLK_WORLD_87		= 247,
	SDLK_WORLD_88		= 248,
	SDLK_WORLD_89		= 249,
	SDLK_WORLD_90		= 250,
	SDLK_WORLD_91		= 251,
	SDLK_WORLD_92		= 252,
	SDLK_WORLD_93		= 253,
	SDLK_WORLD_94		= 254,
	SDLK_WORLD_95		= 255,		/* 0xFF */
        /*@}*/

	/** @name Numeric keypad */
        /*@{*/
	SDLK_KP0		= 256,
	SDLK_KP1		= 257,
	SDLK_KP2		= 258,
	SDLK_KP3		= 259,
	SDLK_KP4		= 260,
	SDLK_KP5		= 261,
	SDLK_KP6		= 262,
	SDLK_KP7		= 263,
	SDLK_KP8		= 264,
	SDLK_KP9		= 265,
	SDLK_KP_PERIOD		= 266,
	SDLK_KP_DIVIDE		= 267,
	SDLK_KP_MULTIPLY	= 268,
	SDLK_KP_MINUS		= 269,
	SDLK_KP_PLUS		= 270,
	SDLK_KP_ENTER		= 271,
	SDLK_KP_EQUALS		= 272,
        /*@}*/

	/** @name Arrows + Home/End pad */
        /*@{*/
	SDLK_UP			= 273,
	SDLK_DOWN		= 274,
	SDLK_RIGHT		= 275,
	SDLK_LEFT		= 276,
	SDLK_INSERT		= 277,
	SDLK_HOME		= 278,
	SDLK_END		= 279,
	SDLK_PAGEUP		= 280,
	SDLK_PAGEDOWN		= 281,
        /*@}*/

	/** @name Function keys */
        /*@{*/
	SDLK_F1			= 282,
	SDLK_F2			= 283,
	SDLK_F3			= 284,
	SDLK_F4			= 285,
	SDLK_F5			= 286,
	SDLK_F6			= 287,
	SDLK_F7			= 288,
	SDLK_F8			= 289,
	SDLK_F9			= 290,
	SDLK_F10		= 291,
	SDLK_F11		= 292,
	SDLK_F12		= 293,
	SDLK_F13		= 294,
	SDLK_F14		= 295,
	SDLK_F15		= 296,
        /*@}*/

	/** @name Key state modifier keys */
        /*@{*/
	SDLK_NUMLOCK		= 300,
	SDLK_CAPSLOCK		= 301,
	SDLK_SCROLLOCK		= 302,
	SDLK_RSHIFT		= 303,
	SDLK_LSHIFT		= 304,
	SDLK_RCTRL		= 305,
	SDLK_LCTRL		= 306,
	SDLK_RALT		= 307,
	SDLK_LALT		= 308,
	SDLK_RMETA		= 309,
	SDLK_LMETA		= 310,
	SDLK_LSUPER		= 311,		/**< Left "Windows" key */
	SDLK_RSUPER		= 312,		/**< Right "Windows" key */
	SDLK_MODE		= 313,		/**< "Alt Gr" key */
	SDLK_COMPOSE		= 314,		/**< Multi-key compose key */
        /*@}*/

	/** @name Miscellaneous function keys */
        /*@{*/
	SDLK_HELP		= 315,
	SDLK_PRINT		= 316,
	SDLK_SYSREQ		= 317,
	SDLK_BREAK		= 318,
	SDLK_MENU		= 319,
	SDLK_POWER		= 320,		/**< Power Macintosh power key */
	SDLK_EURO		= 321,		/**< Some european keyboards */
	SDLK_UNDO		= 322,		/**< Atari keyboard has Undo */
        /*@}*/

	/* Add any other keys here */

	SDLK_LAST
} SDLKey;

/** Enumeration of valid key mods (possibly OR'd together) */
typedef enum {
	KMOD_NONE  = 0x0000,
	KMOD_LSHIFT= 0x0001,
	KMOD_RSHIFT= 0x0002,
	KMOD_LCTRL = 0x0040,
	KMOD_RCTRL = 0x0080,
	KMOD_LALT  = 0x0100,
	KMOD_RALT  = 0x0200,
	KMOD_LMETA = 0x0400,
	KMOD_RMETA = 0x0800,
	KMOD_NUM   = 0x1000,
	KMOD_CAPS  = 0x2000,
	KMOD_MODE  = 0x4000,
	KMOD_RESERVED = 0x8000
} SDLMod;

#define KMOD_CTRL	(KMOD_LCTRL|KMOD_RCTRL)
#define KMOD_SHIFT	(KMOD_LSHIFT|KMOD_RSHIFT)
#define KMOD_ALT	(KMOD_LALT|KMOD_RALT)
#define KMOD_META	(KMOD_LMETA|KMOD_RMETA)

#endif /* _SDL_keysym_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_loadso.h.





























































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_loadso.h
 *  System dependent library loading routines
 */

/** @file SDL_loadso.h
 *  Some things to keep in mind:                                        
 *  - These functions only work on C function names.  Other languages may
 *    have name mangling and intrinsic language support that varies from
 *    compiler to compiler.
 *  - Make sure you declare your function pointers with the same calling
 *    convention as the actual library function.  Your code will crash
 *    mysteriously if you do not do this.
 *  - Avoid namespace collisions.  If you load a symbol from the library,
 *    it is not defined whether or not it goes into the global symbol
 *    namespace for the application.  If it does and it conflicts with
 *    symbols in your code or other shared libraries, you will not get
 *    the results you expect. :)
 */


#ifndef _SDL_loadso_h
#define _SDL_loadso_h

#include "SDL_stdinc.h"
#include "SDL_error.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/**
 * This function dynamically loads a shared object and returns a pointer
 * to the object handle (or NULL if there was an error).
 * The 'sofile' parameter is a system dependent name of the object file.
 */
extern DECLSPEC void * SDLCALL SDL_LoadObject(const char *sofile);

/**
 * Given an object handle, this function looks up the address of the
 * named function in the shared object and returns it.  This address
 * is no longer valid after calling SDL_UnloadObject().
 */
extern DECLSPEC void * SDLCALL SDL_LoadFunction(void *handle, const char *name);

/** Unload a shared object from memory */
extern DECLSPEC void SDLCALL SDL_UnloadObject(void *handle);

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_loadso_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_main.h.





















































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

#ifndef _SDL_main_h
#define _SDL_main_h

#include "SDL_stdinc.h"

/** @file SDL_main.h
 *  Redefine main() on Win32 and MacOS so that it is called by winmain.c
 */

#if defined(__WIN32__) || \
    (defined(__MWERKS__) && !defined(__BEOS__)) || \
    defined(__MACOS__) || defined(__MACOSX__) || \
    defined(__SYMBIAN32__) || defined(QWS)

#ifdef __cplusplus
#define C_LINKAGE	"C"
#else
#define C_LINKAGE
#endif /* __cplusplus */

/** The application's main() function must be called with C linkage,
 *  and should be declared like this:
 *      @code
 *      #ifdef __cplusplus
 *      extern "C"
 *      #endif
 *	int main(int argc, char *argv[])
 *	{
 *	}
 *      @endcode
 */
#define main	SDL_main

/** The prototype for the application's main() function */
extern C_LINKAGE int SDL_main(int argc, char *argv[]);


/** @name From the SDL library code -- needed for registering the app on Win32 */
/*@{*/
#ifdef __WIN32__

#include "begin_code.h"
#ifdef __cplusplus
extern "C" {
#endif

/** This should be called from your WinMain() function, if any */
extern DECLSPEC void SDLCALL SDL_SetModuleHandle(void *hInst);
/** This can also be called, but is no longer necessary */
extern DECLSPEC int SDLCALL SDL_RegisterApp(char *name, Uint32 style, void *hInst);
/** This can also be called, but is no longer necessary (SDL_Quit calls it) */
extern DECLSPEC void SDLCALL SDL_UnregisterApp(void);
#ifdef __cplusplus
}
#endif
#include "close_code.h"
#endif
/*@}*/

/** @name From the SDL library code -- needed for registering QuickDraw on MacOS */
/*@{*/
#if defined(__MACOS__)

#include "begin_code.h"
#ifdef __cplusplus
extern "C" {
#endif

/** Forward declaration so we don't need to include QuickDraw.h */
struct QDGlobals;

/** This should be called from your main() function, if any */
extern DECLSPEC void SDLCALL SDL_InitQuickDraw(struct QDGlobals *the_qd);

#ifdef __cplusplus
}
#endif
#include "close_code.h"
#endif
/*@}*/

#endif /* Need to redefine main()? */

#endif /* _SDL_main_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_mouse.h.































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_mouse.h
 *  Include file for SDL mouse event handling
 */

#ifndef _SDL_mouse_h
#define _SDL_mouse_h

#include "SDL_stdinc.h"
#include "SDL_error.h"
#include "SDL_video.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

typedef struct WMcursor WMcursor;	/**< Implementation dependent */
typedef struct SDL_Cursor {
	SDL_Rect area;			/**< The area of the mouse cursor */
	Sint16 hot_x, hot_y;		/**< The "tip" of the cursor */
	Uint8 *data;			/**< B/W cursor data */
	Uint8 *mask;			/**< B/W cursor mask */
	Uint8 *save[2];			/**< Place to save cursor area */
	WMcursor *wm_cursor;		/**< Window-manager cursor */
} SDL_Cursor;

/* Function prototypes */
/**
 * Retrieve the current state of the mouse.
 * The current button state is returned as a button bitmask, which can
 * be tested using the SDL_BUTTON(X) macros, and x and y are set to the
 * current mouse cursor position.  You can pass NULL for either x or y.
 */
extern DECLSPEC Uint8 SDLCALL SDL_GetMouseState(int *x, int *y);

/**
 * Retrieve the current state of the mouse.
 * The current button state is returned as a button bitmask, which can
 * be tested using the SDL_BUTTON(X) macros, and x and y are set to the
 * mouse deltas since the last call to SDL_GetRelativeMouseState().
 */
extern DECLSPEC Uint8 SDLCALL SDL_GetRelativeMouseState(int *x, int *y);

/**
 * Set the position of the mouse cursor (generates a mouse motion event)
 */
extern DECLSPEC void SDLCALL SDL_WarpMouse(Uint16 x, Uint16 y);

/**
 * Create a cursor using the specified data and mask (in MSB format).
 * The cursor width must be a multiple of 8 bits.
 *
 * The cursor is created in black and white according to the following:
 * data  mask    resulting pixel on screen
 *  0     1       White
 *  1     1       Black
 *  0     0       Transparent
 *  1     0       Inverted color if possible, black if not.
 *
 * Cursors created with this function must be freed with SDL_FreeCursor().
 */
extern DECLSPEC SDL_Cursor * SDLCALL SDL_CreateCursor
		(Uint8 *data, Uint8 *mask, int w, int h, int hot_x, int hot_y);

/**
 * Set the currently active cursor to the specified one.
 * If the cursor is currently visible, the change will be immediately 
 * represented on the display.
 */
extern DECLSPEC void SDLCALL SDL_SetCursor(SDL_Cursor *cursor);

/**
 * Returns the currently active cursor.
 */
extern DECLSPEC SDL_Cursor * SDLCALL SDL_GetCursor(void);

/**
 * Deallocates a cursor created with SDL_CreateCursor().
 */
extern DECLSPEC void SDLCALL SDL_FreeCursor(SDL_Cursor *cursor);

/**
 * Toggle whether or not the cursor is shown on the screen.
 * The cursor start off displayed, but can be turned off.
 * SDL_ShowCursor() returns 1 if the cursor was being displayed
 * before the call, or 0 if it was not.  You can query the current
 * state by passing a 'toggle' value of -1.
 */
extern DECLSPEC int SDLCALL SDL_ShowCursor(int toggle);

/*@{*/
/** Used as a mask when testing buttons in buttonstate
 *  Button 1:	Left mouse button
 *  Button 2:	Middle mouse button
 *  Button 3:	Right mouse button
 *  Button 4:	Mouse wheel up	 (may also be a real button)
 *  Button 5:	Mouse wheel down (may also be a real button)
 */
#define SDL_BUTTON(X)		(1 << ((X)-1))
#define SDL_BUTTON_LEFT		1
#define SDL_BUTTON_MIDDLE	2
#define SDL_BUTTON_RIGHT	3
#define SDL_BUTTON_WHEELUP	4
#define SDL_BUTTON_WHEELDOWN	5
#define SDL_BUTTON_X1		6
#define SDL_BUTTON_X2		7
#define SDL_BUTTON_LMASK	SDL_BUTTON(SDL_BUTTON_LEFT)
#define SDL_BUTTON_MMASK	SDL_BUTTON(SDL_BUTTON_MIDDLE)
#define SDL_BUTTON_RMASK	SDL_BUTTON(SDL_BUTTON_RIGHT)
#define SDL_BUTTON_X1MASK	SDL_BUTTON(SDL_BUTTON_X1)
#define SDL_BUTTON_X2MASK	SDL_BUTTON(SDL_BUTTON_X2)
/*@}*/

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_mouse_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_mutex.h.



































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

#ifndef _SDL_mutex_h
#define _SDL_mutex_h

/** @file SDL_mutex.h
 *  Functions to provide thread synchronization primitives
 *
 *  @note These are independent of the other SDL routines.
 */

#include "SDL_stdinc.h"
#include "SDL_error.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** Synchronization functions which can time out return this value
 *  if they time out.
 */
#define SDL_MUTEX_TIMEDOUT	1

/** This is the timeout value which corresponds to never time out */
#define SDL_MUTEX_MAXWAIT	(~(Uint32)0)


/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
/** @name Mutex functions                                        */ /*@{*/
/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */

/** The SDL mutex structure, defined in SDL_mutex.c */
struct SDL_mutex;
typedef struct SDL_mutex SDL_mutex;

/** Create a mutex, initialized unlocked */
extern DECLSPEC SDL_mutex * SDLCALL SDL_CreateMutex(void);

#define SDL_LockMutex(m)	SDL_mutexP(m)
/** Lock the mutex
 *  @return 0, or -1 on error
 */
extern DECLSPEC int SDLCALL SDL_mutexP(SDL_mutex *mutex);

#define SDL_UnlockMutex(m)	SDL_mutexV(m)
/** Unlock the mutex
 *  @return 0, or -1 on error
 *
 *  It is an error to unlock a mutex that has not been locked by
 *  the current thread, and doing so results in undefined behavior.
 */
extern DECLSPEC int SDLCALL SDL_mutexV(SDL_mutex *mutex);

/** Destroy a mutex */
extern DECLSPEC void SDLCALL SDL_DestroyMutex(SDL_mutex *mutex);

/*@}*/

/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
/** @name Semaphore functions                                    */ /*@{*/
/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */

/** The SDL semaphore structure, defined in SDL_sem.c */
struct SDL_semaphore;
typedef struct SDL_semaphore SDL_sem;

/** Create a semaphore, initialized with value, returns NULL on failure. */
extern DECLSPEC SDL_sem * SDLCALL SDL_CreateSemaphore(Uint32 initial_value);

/** Destroy a semaphore */
extern DECLSPEC void SDLCALL SDL_DestroySemaphore(SDL_sem *sem);

/**
 * This function suspends the calling thread until the semaphore pointed 
 * to by sem has a positive count. It then atomically decreases the semaphore
 * count.
 */
extern DECLSPEC int SDLCALL SDL_SemWait(SDL_sem *sem);

/** Non-blocking variant of SDL_SemWait().
 *  @return 0 if the wait succeeds,
 *  SDL_MUTEX_TIMEDOUT if the wait would block, and -1 on error.
 */
extern DECLSPEC int SDLCALL SDL_SemTryWait(SDL_sem *sem);

/** Variant of SDL_SemWait() with a timeout in milliseconds, returns 0 if
 *  the wait succeeds, SDL_MUTEX_TIMEDOUT if the wait does not succeed in
 *  the allotted time, and -1 on error.
 *
 *  On some platforms this function is implemented by looping with a delay
 *  of 1 ms, and so should be avoided if possible.
 */
extern DECLSPEC int SDLCALL SDL_SemWaitTimeout(SDL_sem *sem, Uint32 ms);

/** Atomically increases the semaphore's count (not blocking).
 *  @return 0, or -1 on error.
 */
extern DECLSPEC int SDLCALL SDL_SemPost(SDL_sem *sem);

/** Returns the current count of the semaphore */
extern DECLSPEC Uint32 SDLCALL SDL_SemValue(SDL_sem *sem);

/*@}*/

/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */
/** @name Condition_variable_functions                           */ /*@{*/
/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */

/*@{*/
/** The SDL condition variable structure, defined in SDL_cond.c */
struct SDL_cond;
typedef struct SDL_cond SDL_cond;
/*@}*/

/** Create a condition variable */
extern DECLSPEC SDL_cond * SDLCALL SDL_CreateCond(void);

/** Destroy a condition variable */
extern DECLSPEC void SDLCALL SDL_DestroyCond(SDL_cond *cond);

/** Restart one of the threads that are waiting on the condition variable,
 *  @return 0 or -1 on error.
 */
extern DECLSPEC int SDLCALL SDL_CondSignal(SDL_cond *cond);

/** Restart all threads that are waiting on the condition variable,
 *  @return 0 or -1 on error.
 */
extern DECLSPEC int SDLCALL SDL_CondBroadcast(SDL_cond *cond);

/** Wait on the condition variable, unlocking the provided mutex.
 *  The mutex must be locked before entering this function!
 *  The mutex is re-locked once the condition variable is signaled.
 *  @return 0 when it is signaled, or -1 on error.
 */
extern DECLSPEC int SDLCALL SDL_CondWait(SDL_cond *cond, SDL_mutex *mut);

/** Waits for at most 'ms' milliseconds, and returns 0 if the condition
 *  variable is signaled, SDL_MUTEX_TIMEDOUT if the condition is not
 *  signaled in the allotted time, and -1 on error.
 *  On some platforms this function is implemented by looping with a delay
 *  of 1 ms, and so should be avoided if possible.
 */
extern DECLSPEC int SDLCALL SDL_CondWaitTimeout(SDL_cond *cond, SDL_mutex *mutex, Uint32 ms);

/*@}*/

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_mutex_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_name.h.























>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11

#ifndef _SDLname_h_
#define _SDLname_h_

#if defined(__STDC__) || defined(__cplusplus)
#define NeedFunctionPrototypes 1
#endif

#define SDL_NAME(X)	SDL_##X

#endif /* _SDLname_h_ */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_opengl.h.





















































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
459
460
461
462
463
464
465
466
467
468
469
470
471
472
473
474
475
476
477
478
479
480
481
482
483
484
485
486
487
488
489
490
491
492
493
494
495
496
497
498
499
500
501
502
503
504
505
506
507
508
509
510
511
512
513
514
515
516
517
518
519
520
521
522
523
524
525
526
527
528
529
530
531
532
533
534
535
536
537
538
539
540
541
542
543
544
545
546
547
548
549
550
551
552
553
554
555
556
557
558
559
560
561
562
563
564
565
566
567
568
569
570
571
572
573
574
575
576
577
578
579
580
581
582
583
584
585
586
587
588
589
590
591
592
593
594
595
596
597
598
599
600
601
602
603
604
605
606
607
608
609
610
611
612
613
614
615
616
617
618
619
620
621
622
623
624
625
626
627
628
629
630
631
632
633
634
635
636
637
638
639
640
641
642
643
644
645
646
647
648
649
650
651
652
653
654
655
656
657
658
659
660
661
662
663
664
665
666
667
668
669
670
671
672
673
674
675
676
677
678
679
680
681
682
683
684
685
686
687
688
689
690
691
692
693
694
695
696
697
698
699
700
701
702
703
704
705
706
707
708
709
710
711
712
713
714
715
716
717
718
719
720
721
722
723
724
725
726
727
728
729
730
731
732
733
734
735
736
737
738
739
740
741
742
743
744
745
746
747
748
749
750
751
752
753
754
755
756
757
758
759
760
761
762
763
764
765
766
767
768
769
770
771
772
773
774
775
776
777
778
779
780
781
782
783
784
785
786
787
788
789
790
791
792
793
794
795
796
797
798
799
800
801
802
803
804
805
806
807
808
809
810
811
812
813
814
815
816
817
818
819
820
821
822
823
824
825
826
827
828
829
830
831
832
833
834
835
836
837
838
839
840
841
842
843
844
845
846
847
848
849
850
851
852
853
854
855
856
857
858
859
860
861
862
863
864
865
866
867
868
869
870
871
872
873
874
875
876
877
878
879
880
881
882
883
884
885
886
887
888
889
890
891
892
893
894
895
896
897
898
899
900
901
902
903
904
905
906
907
908
909
910
911
912
913
914
915
916
917
918
919
920
921
922
923
924
925
926
927
928
929
930
931
932
933
934
935
936
937
938
939
940
941
942
943
944
945
946
947
948
949
950
951
952
953
954
955
956
957
958
959
960
961
962
963
964
965
966
967
968
969
970
971
972
973
974
975
976
977
978
979
980
981
982
983
984
985
986
987
988
989
990
991
992
993
994
995
996
997
998
999
1000
1001
1002
1003
1004
1005
1006
1007
1008
1009
1010
1011
1012
1013
1014
1015
1016
1017
1018
1019
1020
1021
1022
1023
1024
1025
1026
1027
1028
1029
1030
1031
1032
1033
1034
1035
1036
1037
1038
1039
1040
1041
1042
1043
1044
1045
1046
1047
1048
1049
1050
1051
1052
1053
1054
1055
1056
1057
1058
1059
1060
1061
1062
1063
1064
1065
1066
1067
1068
1069
1070
1071
1072
1073
1074
1075
1076
1077
1078
1079
1080
1081
1082
1083
1084
1085
1086
1087
1088
1089
1090
1091
1092
1093
1094
1095
1096
1097
1098
1099
1100
1101
1102
1103
1104
1105
1106
1107
1108
1109
1110
1111
1112
1113
1114
1115
1116
1117
1118
1119
1120
1121
1122
1123
1124
1125
1126
1127
1128
1129
1130
1131
1132
1133
1134
1135
1136
1137
1138
1139
1140
1141
1142
1143
1144
1145
1146
1147
1148
1149
1150
1151
1152
1153
1154
1155
1156
1157
1158
1159
1160
1161
1162
1163
1164
1165
1166
1167
1168
1169
1170
1171
1172
1173
1174
1175
1176
1177
1178
1179
1180
1181
1182
1183
1184
1185
1186
1187
1188
1189
1190
1191
1192
1193
1194
1195
1196
1197
1198
1199
1200
1201
1202
1203
1204
1205
1206
1207
1208
1209
1210
1211
1212
1213
1214
1215
1216
1217
1218
1219
1220
1221
1222
1223
1224
1225
1226
1227
1228
1229
1230
1231
1232
1233
1234
1235
1236
1237
1238
1239
1240
1241
1242
1243
1244
1245
1246
1247
1248
1249
1250
1251
1252
1253
1254
1255
1256
1257
1258
1259
1260
1261
1262
1263
1264
1265
1266
1267
1268
1269
1270
1271
1272
1273
1274
1275
1276
1277
1278
1279
1280
1281
1282
1283
1284
1285
1286
1287
1288
1289
1290
1291
1292
1293
1294
1295
1296
1297
1298
1299
1300
1301
1302
1303
1304
1305
1306
1307
1308
1309
1310
1311
1312
1313
1314
1315
1316
1317
1318
1319
1320
1321
1322
1323
1324
1325
1326
1327
1328
1329
1330
1331
1332
1333
1334
1335
1336
1337
1338
1339
1340
1341
1342
1343
1344
1345
1346
1347
1348
1349
1350
1351
1352
1353
1354
1355
1356
1357
1358
1359
1360
1361
1362
1363
1364
1365
1366
1367
1368
1369
1370
1371
1372
1373
1374
1375
1376
1377
1378
1379
1380
1381
1382
1383
1384
1385
1386
1387
1388
1389
1390
1391
1392
1393
1394
1395
1396
1397
1398
1399
1400
1401
1402
1403
1404
1405
1406
1407
1408
1409
1410
1411
1412
1413
1414
1415
1416
1417
1418
1419
1420
1421
1422
1423
1424
1425
1426
1427
1428
1429
1430
1431
1432
1433
1434
1435
1436
1437
1438
1439
1440
1441
1442
1443
1444
1445
1446
1447
1448
1449
1450
1451
1452
1453
1454
1455
1456
1457
1458
1459
1460
1461
1462
1463
1464
1465
1466
1467
1468
1469
1470
1471
1472
1473
1474
1475
1476
1477
1478
1479
1480
1481
1482
1483
1484
1485
1486
1487
1488
1489
1490
1491
1492
1493
1494
1495
1496
1497
1498
1499
1500
1501
1502
1503
1504
1505
1506
1507
1508
1509
1510
1511
1512
1513
1514
1515
1516
1517
1518
1519
1520
1521
1522
1523
1524
1525
1526
1527
1528
1529
1530
1531
1532
1533
1534
1535
1536
1537
1538
1539
1540
1541
1542
1543
1544
1545
1546
1547
1548
1549
1550
1551
1552
1553
1554
1555
1556
1557
1558
1559
1560
1561
1562
1563
1564
1565
1566
1567
1568
1569
1570
1571
1572
1573
1574
1575
1576
1577
1578
1579
1580
1581
1582
1583
1584
1585
1586
1587
1588
1589
1590
1591
1592
1593
1594
1595
1596
1597
1598
1599
1600
1601
1602
1603
1604
1605
1606
1607
1608
1609
1610
1611
1612
1613
1614
1615
1616
1617
1618
1619
1620
1621
1622
1623
1624
1625
1626
1627
1628
1629
1630
1631
1632
1633
1634
1635
1636
1637
1638
1639
1640
1641
1642
1643
1644
1645
1646
1647
1648
1649
1650
1651
1652
1653
1654
1655
1656
1657
1658
1659
1660
1661
1662
1663
1664
1665
1666
1667
1668
1669
1670
1671
1672
1673
1674
1675
1676
1677
1678
1679
1680
1681
1682
1683
1684
1685
1686
1687
1688
1689
1690
1691
1692
1693
1694
1695
1696
1697
1698
1699
1700
1701
1702
1703
1704
1705
1706
1707
1708
1709
1710
1711
1712
1713
1714
1715
1716
1717
1718
1719
1720
1721
1722
1723
1724
1725
1726
1727
1728
1729
1730
1731
1732
1733
1734
1735
1736
1737
1738
1739
1740
1741
1742
1743
1744
1745
1746
1747
1748
1749
1750
1751
1752
1753
1754
1755
1756
1757
1758
1759
1760
1761
1762
1763
1764
1765
1766
1767
1768
1769
1770
1771
1772
1773
1774
1775
1776
1777
1778
1779
1780
1781
1782
1783
1784
1785
1786
1787
1788
1789
1790
1791
1792
1793
1794
1795
1796
1797
1798
1799
1800
1801
1802
1803
1804
1805
1806
1807
1808
1809
1810
1811
1812
1813
1814
1815
1816
1817
1818
1819
1820
1821
1822
1823
1824
1825
1826
1827
1828
1829
1830
1831
1832
1833
1834
1835
1836
1837
1838
1839
1840
1841
1842
1843
1844
1845
1846
1847
1848
1849
1850
1851
1852
1853
1854
1855
1856
1857
1858
1859
1860
1861
1862
1863
1864
1865
1866
1867
1868
1869
1870
1871
1872
1873
1874
1875
1876
1877
1878
1879
1880
1881
1882
1883
1884
1885
1886
1887
1888
1889
1890
1891
1892
1893
1894
1895
1896
1897
1898
1899
1900
1901
1902
1903
1904
1905
1906
1907
1908
1909
1910
1911
1912
1913
1914
1915
1916
1917
1918
1919
1920
1921
1922
1923
1924
1925
1926
1927
1928
1929
1930
1931
1932
1933
1934
1935
1936
1937
1938
1939
1940
1941
1942
1943
1944
1945
1946
1947
1948
1949
1950
1951
1952
1953
1954
1955
1956
1957
1958
1959
1960
1961
1962
1963
1964
1965
1966
1967
1968
1969
1970
1971
1972
1973
1974
1975
1976
1977
1978
1979
1980
1981
1982
1983
1984
1985
1986
1987
1988
1989
1990
1991
1992
1993
1994
1995
1996
1997
1998
1999
2000
2001
2002
2003
2004
2005
2006
2007
2008
2009
2010
2011
2012
2013
2014
2015
2016
2017
2018
2019
2020
2021
2022
2023
2024
2025
2026
2027
2028
2029
2030
2031
2032
2033
2034
2035
2036
2037
2038
2039
2040
2041
2042
2043
2044
2045
2046
2047
2048
2049
2050
2051
2052
2053
2054
2055
2056
2057
2058
2059
2060
2061
2062
2063
2064
2065
2066
2067
2068
2069
2070
2071
2072
2073
2074
2075
2076
2077
2078
2079
2080
2081
2082
2083
2084
2085
2086
2087
2088
2089
2090
2091
2092
2093
2094
2095
2096
2097
2098
2099
2100
2101
2102
2103
2104
2105
2106
2107
2108
2109
2110
2111
2112
2113
2114
2115
2116
2117
2118
2119
2120
2121
2122
2123
2124
2125
2126
2127
2128
2129
2130
2131
2132
2133
2134
2135
2136
2137
2138
2139
2140
2141
2142
2143
2144
2145
2146
2147
2148
2149
2150
2151
2152
2153
2154
2155
2156
2157
2158
2159
2160
2161
2162
2163
2164
2165
2166
2167
2168
2169
2170
2171
2172
2173
2174
2175
2176
2177
2178
2179
2180
2181
2182
2183
2184
2185
2186
2187
2188
2189
2190
2191
2192
2193
2194
2195
2196
2197
2198
2199
2200
2201
2202
2203
2204
2205
2206
2207
2208
2209
2210
2211
2212
2213
2214
2215
2216
2217
2218
2219
2220
2221
2222
2223
2224
2225
2226
2227
2228
2229
2230
2231
2232
2233
2234
2235
2236
2237
2238
2239
2240
2241
2242
2243
2244
2245
2246
2247
2248
2249
2250
2251
2252
2253
2254
2255
2256
2257
2258
2259
2260
2261
2262
2263
2264
2265
2266
2267
2268
2269
2270
2271
2272
2273
2274
2275
2276
2277
2278
2279
2280
2281
2282
2283
2284
2285
2286
2287
2288
2289
2290
2291
2292
2293
2294
2295
2296
2297
2298
2299
2300
2301
2302
2303
2304
2305
2306
2307
2308
2309
2310
2311
2312
2313
2314
2315
2316
2317
2318
2319
2320
2321
2322
2323
2324
2325
2326
2327
2328
2329
2330
2331
2332
2333
2334
2335
2336
2337
2338
2339
2340
2341
2342
2343
2344
2345
2346
2347
2348
2349
2350
2351
2352
2353
2354
2355
2356
2357
2358
2359
2360
2361
2362
2363
2364
2365
2366
2367
2368
2369
2370
2371
2372
2373
2374
2375
2376
2377
2378
2379
2380
2381
2382
2383
2384
2385
2386
2387
2388
2389
2390
2391
2392
2393
2394
2395
2396
2397
2398
2399
2400
2401
2402
2403
2404
2405
2406
2407
2408
2409
2410
2411
2412
2413
2414
2415
2416
2417
2418
2419
2420
2421
2422
2423
2424
2425
2426
2427
2428
2429
2430
2431
2432
2433
2434
2435
2436
2437
2438
2439
2440
2441
2442
2443
2444
2445
2446
2447
2448
2449
2450
2451
2452
2453
2454
2455
2456
2457
2458
2459
2460
2461
2462
2463
2464
2465
2466
2467
2468
2469
2470
2471
2472
2473
2474
2475
2476
2477
2478
2479
2480
2481
2482
2483
2484
2485
2486
2487
2488
2489
2490
2491
2492
2493
2494
2495
2496
2497
2498
2499
2500
2501
2502
2503
2504
2505
2506
2507
2508
2509
2510
2511
2512
2513
2514
2515
2516
2517
2518
2519
2520
2521
2522
2523
2524
2525
2526
2527
2528
2529
2530
2531
2532
2533
2534
2535
2536
2537
2538
2539
2540
2541
2542
2543
2544
2545
2546
2547
2548
2549
2550
2551
2552
2553
2554
2555
2556
2557
2558
2559
2560
2561
2562
2563
2564
2565
2566
2567
2568
2569
2570
2571
2572
2573
2574
2575
2576
2577
2578
2579
2580
2581
2582
2583
2584
2585
2586
2587
2588
2589
2590
2591
2592
2593
2594
2595
2596
2597
2598
2599
2600
2601
2602
2603
2604
2605
2606
2607
2608
2609
2610
2611
2612
2613
2614
2615
2616
2617
2618
2619
2620
2621
2622
2623
2624
2625
2626
2627
2628
2629
2630
2631
2632
2633
2634
2635
2636
2637
2638
2639
2640
2641
2642
2643
2644
2645
2646
2647
2648
2649
2650
2651
2652
2653
2654
2655
2656
2657
2658
2659
2660
2661
2662
2663
2664
2665
2666
2667
2668
2669
2670
2671
2672
2673
2674
2675
2676
2677
2678
2679
2680
2681
2682
2683
2684
2685
2686
2687
2688
2689
2690
2691
2692
2693
2694
2695
2696
2697
2698
2699
2700
2701
2702
2703
2704
2705
2706
2707
2708
2709
2710
2711
2712
2713
2714
2715
2716
2717
2718
2719
2720
2721
2722
2723
2724
2725
2726
2727
2728
2729
2730
2731
2732
2733
2734
2735
2736
2737
2738
2739
2740
2741
2742
2743
2744
2745
2746
2747
2748
2749
2750
2751
2752
2753
2754
2755
2756
2757
2758
2759
2760
2761
2762
2763
2764
2765
2766
2767
2768
2769
2770
2771
2772
2773
2774
2775
2776
2777
2778
2779
2780
2781
2782
2783
2784
2785
2786
2787
2788
2789
2790
2791
2792
2793
2794
2795
2796
2797
2798
2799
2800
2801
2802
2803
2804
2805
2806
2807
2808
2809
2810
2811
2812
2813
2814
2815
2816
2817
2818
2819
2820
2821
2822
2823
2824
2825
2826
2827
2828
2829
2830
2831
2832
2833
2834
2835
2836
2837
2838
2839
2840
2841
2842
2843
2844
2845
2846
2847
2848
2849
2850
2851
2852
2853
2854
2855
2856
2857
2858
2859
2860
2861
2862
2863
2864
2865
2866
2867
2868
2869
2870
2871
2872
2873
2874
2875
2876
2877
2878
2879
2880
2881
2882
2883
2884
2885
2886
2887
2888
2889
2890
2891
2892
2893
2894
2895
2896
2897
2898
2899
2900
2901
2902
2903
2904
2905
2906
2907
2908
2909
2910
2911
2912
2913
2914
2915
2916
2917
2918
2919
2920
2921
2922
2923
2924
2925
2926
2927
2928
2929
2930
2931
2932
2933
2934
2935
2936
2937
2938
2939
2940
2941
2942
2943
2944
2945
2946
2947
2948
2949
2950
2951
2952
2953
2954
2955
2956
2957
2958
2959
2960
2961
2962
2963
2964
2965
2966
2967
2968
2969
2970
2971
2972
2973
2974
2975
2976
2977
2978
2979
2980
2981
2982
2983
2984
2985
2986
2987
2988
2989
2990
2991
2992
2993
2994
2995
2996
2997
2998
2999
3000
3001
3002
3003
3004
3005
3006
3007
3008
3009
3010
3011
3012
3013
3014
3015
3016
3017
3018
3019
3020
3021
3022
3023
3024
3025
3026
3027
3028
3029
3030
3031
3032
3033
3034
3035
3036
3037
3038
3039
3040
3041
3042
3043
3044
3045
3046
3047
3048
3049
3050
3051
3052
3053
3054
3055
3056
3057
3058
3059
3060
3061
3062
3063
3064
3065
3066
3067
3068
3069
3070
3071
3072
3073
3074
3075
3076
3077
3078
3079
3080
3081
3082
3083
3084
3085
3086
3087
3088
3089
3090
3091
3092
3093
3094
3095
3096
3097
3098
3099
3100
3101
3102
3103
3104
3105
3106
3107
3108
3109
3110
3111
3112
3113
3114
3115
3116
3117
3118
3119
3120
3121
3122
3123
3124
3125
3126
3127
3128
3129
3130
3131
3132
3133
3134
3135
3136
3137
3138
3139
3140
3141
3142
3143
3144
3145
3146
3147
3148
3149
3150
3151
3152
3153
3154
3155
3156
3157
3158
3159
3160
3161
3162
3163
3164
3165
3166
3167
3168
3169
3170
3171
3172
3173
3174
3175
3176
3177
3178
3179
3180
3181
3182
3183
3184
3185
3186
3187
3188
3189
3190
3191
3192
3193
3194
3195
3196
3197
3198
3199
3200
3201
3202
3203
3204
3205
3206
3207
3208
3209
3210
3211
3212
3213
3214
3215
3216
3217
3218
3219
3220
3221
3222
3223
3224
3225
3226
3227
3228
3229
3230
3231
3232
3233
3234
3235
3236
3237
3238
3239
3240
3241
3242
3243
3244
3245
3246
3247
3248
3249
3250
3251
3252
3253
3254
3255
3256
3257
3258
3259
3260
3261
3262
3263
3264
3265
3266
3267
3268
3269
3270
3271
3272
3273
3274
3275
3276
3277
3278
3279
3280
3281
3282
3283
3284
3285
3286
3287
3288
3289
3290
3291
3292
3293
3294
3295
3296
3297
3298
3299
3300
3301
3302
3303
3304
3305
3306
3307
3308
3309
3310
3311
3312
3313
3314
3315
3316
3317
3318
3319
3320
3321
3322
3323
3324
3325
3326
3327
3328
3329
3330
3331
3332
3333
3334
3335
3336
3337
3338
3339
3340
3341
3342
3343
3344
3345
3346
3347
3348
3349
3350
3351
3352
3353
3354
3355
3356
3357
3358
3359
3360
3361
3362
3363
3364
3365
3366
3367
3368
3369
3370
3371
3372
3373
3374
3375
3376
3377
3378
3379
3380
3381
3382
3383
3384
3385
3386
3387
3388
3389
3390
3391
3392
3393
3394
3395
3396
3397
3398
3399
3400
3401
3402
3403
3404
3405
3406
3407
3408
3409
3410
3411
3412
3413
3414
3415
3416
3417
3418
3419
3420
3421
3422
3423
3424
3425
3426
3427
3428
3429
3430
3431
3432
3433
3434
3435
3436
3437
3438
3439
3440
3441
3442
3443
3444
3445
3446
3447
3448
3449
3450
3451
3452
3453
3454
3455
3456
3457
3458
3459
3460
3461
3462
3463
3464
3465
3466
3467
3468
3469
3470
3471
3472
3473
3474
3475
3476
3477
3478
3479
3480
3481
3482
3483
3484
3485
3486
3487
3488
3489
3490
3491
3492
3493
3494
3495
3496
3497
3498
3499
3500
3501
3502
3503
3504
3505
3506
3507
3508
3509
3510
3511
3512
3513
3514
3515
3516
3517
3518
3519
3520
3521
3522
3523
3524
3525
3526
3527
3528
3529
3530
3531
3532
3533
3534
3535
3536
3537
3538
3539
3540
3541
3542
3543
3544
3545
3546
3547
3548
3549
3550
3551
3552
3553
3554
3555
3556
3557
3558
3559
3560
3561
3562
3563
3564
3565
3566
3567
3568
3569
3570
3571
3572
3573
3574
3575
3576
3577
3578
3579
3580
3581
3582
3583
3584
3585
3586
3587
3588
3589
3590
3591
3592
3593
3594
3595
3596
3597
3598
3599
3600
3601
3602
3603
3604
3605
3606
3607
3608
3609
3610
3611
3612
3613
3614
3615
3616
3617
3618
3619
3620
3621
3622
3623
3624
3625
3626
3627
3628
3629
3630
3631
3632
3633
3634
3635
3636
3637
3638
3639
3640
3641
3642
3643
3644
3645
3646
3647
3648
3649
3650
3651
3652
3653
3654
3655
3656
3657
3658
3659
3660
3661
3662
3663
3664
3665
3666
3667
3668
3669
3670
3671
3672
3673
3674
3675
3676
3677
3678
3679
3680
3681
3682
3683
3684
3685
3686
3687
3688
3689
3690
3691
3692
3693
3694
3695
3696
3697
3698
3699
3700
3701
3702
3703
3704
3705
3706
3707
3708
3709
3710
3711
3712
3713
3714
3715
3716
3717
3718
3719
3720
3721
3722
3723
3724
3725
3726
3727
3728
3729
3730
3731
3732
3733
3734
3735
3736
3737
3738
3739
3740
3741
3742
3743
3744
3745
3746
3747
3748
3749
3750
3751
3752
3753
3754
3755
3756
3757
3758
3759
3760
3761
3762
3763
3764
3765
3766
3767
3768
3769
3770
3771
3772
3773
3774
3775
3776
3777
3778
3779
3780
3781
3782
3783
3784
3785
3786
3787
3788
3789
3790
3791
3792
3793
3794
3795
3796
3797
3798
3799
3800
3801
3802
3803
3804
3805
3806
3807
3808
3809
3810
3811
3812
3813
3814
3815
3816
3817
3818
3819
3820
3821
3822
3823
3824
3825
3826
3827
3828
3829
3830
3831
3832
3833
3834
3835
3836
3837
3838
3839
3840
3841
3842
3843
3844
3845
3846
3847
3848
3849
3850
3851
3852
3853
3854
3855
3856
3857
3858
3859
3860
3861
3862
3863
3864
3865
3866
3867
3868
3869
3870
3871
3872
3873
3874
3875
3876
3877
3878
3879
3880
3881
3882
3883
3884
3885
3886
3887
3888
3889
3890
3891
3892
3893
3894
3895
3896
3897
3898
3899
3900
3901
3902
3903
3904
3905
3906
3907
3908
3909
3910
3911
3912
3913
3914
3915
3916
3917
3918
3919
3920
3921
3922
3923
3924
3925
3926
3927
3928
3929
3930
3931
3932
3933
3934
3935
3936
3937
3938
3939
3940
3941
3942
3943
3944
3945
3946
3947
3948
3949
3950
3951
3952
3953
3954
3955
3956
3957
3958
3959
3960
3961
3962
3963
3964
3965
3966
3967
3968
3969
3970
3971
3972
3973
3974
3975
3976
3977
3978
3979
3980
3981
3982
3983
3984
3985
3986
3987
3988
3989
3990
3991
3992
3993
3994
3995
3996
3997
3998
3999
4000
4001
4002
4003
4004
4005
4006
4007
4008
4009
4010
4011
4012
4013
4014
4015
4016
4017
4018
4019
4020
4021
4022
4023
4024
4025
4026
4027
4028
4029
4030
4031
4032
4033
4034
4035
4036
4037
4038
4039
4040
4041
4042
4043
4044
4045
4046
4047
4048
4049
4050
4051
4052
4053
4054
4055
4056
4057
4058
4059
4060
4061
4062
4063
4064
4065
4066
4067
4068
4069
4070
4071
4072
4073
4074
4075
4076
4077
4078
4079
4080
4081
4082
4083
4084
4085
4086
4087
4088
4089
4090
4091
4092
4093
4094
4095
4096
4097
4098
4099
4100
4101
4102
4103
4104
4105
4106
4107
4108
4109
4110
4111
4112
4113
4114
4115
4116
4117
4118
4119
4120
4121
4122
4123
4124
4125
4126
4127
4128
4129
4130
4131
4132
4133
4134
4135
4136
4137
4138
4139
4140
4141
4142
4143
4144
4145
4146
4147
4148
4149
4150
4151
4152
4153
4154
4155
4156
4157
4158
4159
4160
4161
4162
4163
4164
4165
4166
4167
4168
4169
4170
4171
4172
4173
4174
4175
4176
4177
4178
4179
4180
4181
4182
4183
4184
4185
4186
4187
4188
4189
4190
4191
4192
4193
4194
4195
4196
4197
4198
4199
4200
4201
4202
4203
4204
4205
4206
4207
4208
4209
4210
4211
4212
4213
4214
4215
4216
4217
4218
4219
4220
4221
4222
4223
4224
4225
4226
4227
4228
4229
4230
4231
4232
4233
4234
4235
4236
4237
4238
4239
4240
4241
4242
4243
4244
4245
4246
4247
4248
4249
4250
4251
4252
4253
4254
4255
4256
4257
4258
4259
4260
4261
4262
4263
4264
4265
4266
4267
4268
4269
4270
4271
4272
4273
4274
4275
4276
4277
4278
4279
4280
4281
4282
4283
4284
4285
4286
4287
4288
4289
4290
4291
4292
4293
4294
4295
4296
4297
4298
4299
4300
4301
4302
4303
4304
4305
4306
4307
4308
4309
4310
4311
4312
4313
4314
4315
4316
4317
4318
4319
4320
4321
4322
4323
4324
4325
4326
4327
4328
4329
4330
4331
4332
4333
4334
4335
4336
4337
4338
4339
4340
4341
4342
4343
4344
4345
4346
4347
4348
4349
4350
4351
4352
4353
4354
4355
4356
4357
4358
4359
4360
4361
4362
4363
4364
4365
4366
4367
4368
4369
4370
4371
4372
4373
4374
4375
4376
4377
4378
4379
4380
4381
4382
4383
4384
4385
4386
4387
4388
4389
4390
4391
4392
4393
4394
4395
4396
4397
4398
4399
4400
4401
4402
4403
4404
4405
4406
4407
4408
4409
4410
4411
4412
4413
4414
4415
4416
4417
4418
4419
4420
4421
4422
4423
4424
4425
4426
4427
4428
4429
4430
4431
4432
4433
4434
4435
4436
4437
4438
4439
4440
4441
4442
4443
4444
4445
4446
4447
4448
4449
4450
4451
4452
4453
4454
4455
4456
4457
4458
4459
4460
4461
4462
4463
4464
4465
4466
4467
4468
4469
4470
4471
4472
4473
4474
4475
4476
4477
4478
4479
4480
4481
4482
4483
4484
4485
4486
4487
4488
4489
4490
4491
4492
4493
4494
4495
4496
4497
4498
4499
4500
4501
4502
4503
4504
4505
4506
4507
4508
4509
4510
4511
4512
4513
4514
4515
4516
4517
4518
4519
4520
4521
4522
4523
4524
4525
4526
4527
4528
4529
4530
4531
4532
4533
4534
4535
4536
4537
4538
4539
4540
4541
4542
4543
4544
4545
4546
4547
4548
4549
4550
4551
4552
4553
4554
4555
4556
4557
4558
4559
4560
4561
4562
4563
4564
4565
4566
4567
4568
4569
4570
4571
4572
4573
4574
4575
4576
4577
4578
4579
4580
4581
4582
4583
4584
4585
4586
4587
4588
4589
4590
4591
4592
4593
4594
4595
4596
4597
4598
4599
4600
4601
4602
4603
4604
4605
4606
4607
4608
4609
4610
4611
4612
4613
4614
4615
4616
4617
4618
4619
4620
4621
4622
4623
4624
4625
4626
4627
4628
4629
4630
4631
4632
4633
4634
4635
4636
4637
4638
4639
4640
4641
4642
4643
4644
4645
4646
4647
4648
4649
4650
4651
4652
4653
4654
4655
4656
4657
4658
4659
4660
4661
4662
4663
4664
4665
4666
4667
4668
4669
4670
4671
4672
4673
4674
4675
4676
4677
4678
4679
4680
4681
4682
4683
4684
4685
4686
4687
4688
4689
4690
4691
4692
4693
4694
4695
4696
4697
4698
4699
4700
4701
4702
4703
4704
4705
4706
4707
4708
4709
4710
4711
4712
4713
4714
4715
4716
4717
4718
4719
4720
4721
4722
4723
4724
4725
4726
4727
4728
4729
4730
4731
4732
4733
4734
4735
4736
4737
4738
4739
4740
4741
4742
4743
4744
4745
4746
4747
4748
4749
4750
4751
4752
4753
4754
4755
4756
4757
4758
4759
4760
4761
4762
4763
4764
4765
4766
4767
4768
4769
4770
4771
4772
4773
4774
4775
4776
4777
4778
4779
4780
4781
4782
4783
4784
4785
4786
4787
4788
4789
4790
4791
4792
4793
4794
4795
4796
4797
4798
4799
4800
4801
4802
4803
4804
4805
4806
4807
4808
4809
4810
4811
4812
4813
4814
4815
4816
4817
4818
4819
4820
4821
4822
4823
4824
4825
4826
4827
4828
4829
4830
4831
4832
4833
4834
4835
4836
4837
4838
4839
4840
4841
4842
4843
4844
4845
4846
4847
4848
4849
4850
4851
4852
4853
4854
4855
4856
4857
4858
4859
4860
4861
4862
4863
4864
4865
4866
4867
4868
4869
4870
4871
4872
4873
4874
4875
4876
4877
4878
4879
4880
4881
4882
4883
4884
4885
4886
4887
4888
4889
4890
4891
4892
4893
4894
4895
4896
4897
4898
4899
4900
4901
4902
4903
4904
4905
4906
4907
4908
4909
4910
4911
4912
4913
4914
4915
4916
4917
4918
4919
4920
4921
4922
4923
4924
4925
4926
4927
4928
4929
4930
4931
4932
4933
4934
4935
4936
4937
4938
4939
4940
4941
4942
4943
4944
4945
4946
4947
4948
4949
4950
4951
4952
4953
4954
4955
4956
4957
4958
4959
4960
4961
4962
4963
4964
4965
4966
4967
4968
4969
4970
4971
4972
4973
4974
4975
4976
4977
4978
4979
4980
4981
4982
4983
4984
4985
4986
4987
4988
4989
4990
4991
4992
4993
4994
4995
4996
4997
4998
4999
5000
5001
5002
5003
5004
5005
5006
5007
5008
5009
5010
5011
5012
5013
5014
5015
5016
5017
5018
5019
5020
5021
5022
5023
5024
5025
5026
5027
5028
5029
5030
5031
5032
5033
5034
5035
5036
5037
5038
5039
5040
5041
5042
5043
5044
5045
5046
5047
5048
5049
5050
5051
5052
5053
5054
5055
5056
5057
5058
5059
5060
5061
5062
5063
5064
5065
5066
5067
5068
5069
5070
5071
5072
5073
5074
5075
5076
5077
5078
5079
5080
5081
5082
5083
5084
5085
5086
5087
5088
5089
5090
5091
5092
5093
5094
5095
5096
5097
5098
5099
5100
5101
5102
5103
5104
5105
5106
5107
5108
5109
5110
5111
5112
5113
5114
5115
5116
5117
5118
5119
5120
5121
5122
5123
5124
5125
5126
5127
5128
5129
5130
5131
5132
5133
5134
5135
5136
5137
5138
5139
5140
5141
5142
5143
5144
5145
5146
5147
5148
5149
5150
5151
5152
5153
5154
5155
5156
5157
5158
5159
5160
5161
5162
5163
5164
5165
5166
5167
5168
5169
5170
5171
5172
5173
5174
5175
5176
5177
5178
5179
5180
5181
5182
5183
5184
5185
5186
5187
5188
5189
5190
5191
5192
5193
5194
5195
5196
5197
5198
5199
5200
5201
5202
5203
5204
5205
5206
5207
5208
5209
5210
5211
5212
5213
5214
5215
5216
5217
5218
5219
5220
5221
5222
5223
5224
5225
5226
5227
5228
5229
5230
5231
5232
5233
5234
5235
5236
5237
5238
5239
5240
5241
5242
5243
5244
5245
5246
5247
5248
5249
5250
5251
5252
5253
5254
5255
5256
5257
5258
5259
5260
5261
5262
5263
5264
5265
5266
5267
5268
5269
5270
5271
5272
5273
5274
5275
5276
5277
5278
5279
5280
5281
5282
5283
5284
5285
5286
5287
5288
5289
5290
5291
5292
5293
5294
5295
5296
5297
5298
5299
5300
5301
5302
5303
5304
5305
5306
5307
5308
5309
5310
5311
5312
5313
5314
5315
5316
5317
5318
5319
5320
5321
5322
5323
5324
5325
5326
5327
5328
5329
5330
5331
5332
5333
5334
5335
5336
5337
5338
5339
5340
5341
5342
5343
5344
5345
5346
5347
5348
5349
5350
5351
5352
5353
5354
5355
5356
5357
5358
5359
5360
5361
5362
5363
5364
5365
5366
5367
5368
5369
5370
5371
5372
5373
5374
5375
5376
5377
5378
5379
5380
5381
5382
5383
5384
5385
5386
5387
5388
5389
5390
5391
5392
5393
5394
5395
5396
5397
5398
5399
5400
5401
5402
5403
5404
5405
5406
5407
5408
5409
5410
5411
5412
5413
5414
5415
5416
5417
5418
5419
5420
5421
5422
5423
5424
5425
5426
5427
5428
5429
5430
5431
5432
5433
5434
5435
5436
5437
5438
5439
5440
5441
5442
5443
5444
5445
5446
5447
5448
5449
5450
5451
5452
5453
5454
5455
5456
5457
5458
5459
5460
5461
5462
5463
5464
5465
5466
5467
5468
5469
5470
5471
5472
5473
5474
5475
5476
5477
5478
5479
5480
5481
5482
5483
5484
5485
5486
5487
5488
5489
5490
5491
5492
5493
5494
5495
5496
5497
5498
5499
5500
5501
5502
5503
5504
5505
5506
5507
5508
5509
5510
5511
5512
5513
5514
5515
5516
5517
5518
5519
5520
5521
5522
5523
5524
5525
5526
5527
5528
5529
5530
5531
5532
5533
5534
5535
5536
5537
5538
5539
5540
5541
5542
5543
5544
5545
5546
5547
5548
5549
5550
5551
5552
5553
5554
5555
5556
5557
5558
5559
5560
5561
5562
5563
5564
5565
5566
5567
5568
5569
5570
5571
5572
5573
5574
5575
5576
5577
5578
5579
5580
5581
5582
5583
5584
5585
5586
5587
5588
5589
5590
5591
5592
5593
5594
5595
5596
5597
5598
5599
5600
5601
5602
5603
5604
5605
5606
5607
5608
5609
5610
5611
5612
5613
5614
5615
5616
5617
5618
5619
5620
5621
5622
5623
5624
5625
5626
5627
5628
5629
5630
5631
5632
5633
5634
5635
5636
5637
5638
5639
5640
5641
5642
5643
5644
5645
5646
5647
5648
5649
5650
5651
5652
5653
5654
5655
5656
5657
5658
5659
5660
5661
5662
5663
5664
5665
5666
5667
5668
5669
5670
5671
5672
5673
5674
5675
5676
5677
5678
5679
5680
5681
5682
5683
5684
5685
5686
5687
5688
5689
5690
5691
5692
5693
5694
5695
5696
5697
5698
5699
5700
5701
5702
5703
5704
5705
5706
5707
5708
5709
5710
5711
5712
5713
5714
5715
5716
5717
5718
5719
5720
5721
5722
5723
5724
5725
5726
5727
5728
5729
5730
5731
5732
5733
5734
5735
5736
5737
5738
5739
5740
5741
5742
5743
5744
5745
5746
5747
5748
5749
5750
5751
5752
5753
5754
5755
5756
5757
5758
5759
5760
5761
5762
5763
5764
5765
5766
5767
5768
5769
5770
5771
5772
5773
5774
5775
5776
5777
5778
5779
5780
5781
5782
5783
5784
5785
5786
5787
5788
5789
5790
5791
5792
5793
5794
5795
5796
5797
5798
5799
5800
5801
5802
5803
5804
5805
5806
5807
5808
5809
5810
5811
5812
5813
5814
5815
5816
5817
5818
5819
5820
5821
5822
5823
5824
5825
5826
5827
5828
5829
5830
5831
5832
5833
5834
5835
5836
5837
5838
5839
5840
5841
5842
5843
5844
5845
5846
5847
5848
5849
5850
5851
5852
5853
5854
5855
5856
5857
5858
5859
5860
5861
5862
5863
5864
5865
5866
5867
5868
5869
5870
5871
5872
5873
5874
5875
5876
5877
5878
5879
5880
5881
5882
5883
5884
5885
5886
5887
5888
5889
5890
5891
5892
5893
5894
5895
5896
5897
5898
5899
5900
5901
5902
5903
5904
5905
5906
5907
5908
5909
5910
5911
5912
5913
5914
5915
5916
5917
5918
5919
5920
5921
5922
5923
5924
5925
5926
5927
5928
5929
5930
5931
5932
5933
5934
5935
5936
5937
5938
5939
5940
5941
5942
5943
5944
5945
5946
5947
5948
5949
5950
5951
5952
5953
5954
5955
5956
5957
5958
5959
5960
5961
5962
5963
5964
5965
5966
5967
5968
5969
5970
5971
5972
5973
5974
5975
5976
5977
5978
5979
5980
5981
5982
5983
5984
5985
5986
5987
5988
5989
5990
5991
5992
5993
5994
5995
5996
5997
5998
5999
6000
6001
6002
6003
6004
6005
6006
6007
6008
6009
6010
6011
6012
6013
6014
6015
6016
6017
6018
6019
6020
6021
6022
6023
6024
6025
6026
6027
6028
6029
6030
6031
6032
6033
6034
6035
6036
6037
6038
6039
6040
6041
6042
6043
6044
6045
6046
6047
6048
6049
6050
6051
6052
6053
6054
6055
6056
6057
6058
6059
6060
6061
6062
6063
6064
6065
6066
6067
6068
6069
6070
6071
6072
6073
6074
6075
6076
6077
6078
6079
6080
6081
6082
6083
6084
6085
6086
6087
6088
6089
6090
6091
6092
6093
6094
6095
6096
6097
6098
6099
6100
6101
6102
6103
6104
6105
6106
6107
6108
6109
6110
6111
6112
6113
6114
6115
6116
6117
6118
6119
6120
6121
6122
6123
6124
6125
6126
6127
6128
6129
6130
6131
6132
6133
6134
6135
6136
6137
6138
6139
6140
6141
6142
6143
6144
6145
6146
6147
6148
6149
6150
6151
6152
6153
6154
6155
6156
6157
6158
6159
6160
6161
6162
6163
6164
6165
6166
6167
6168
6169
6170
6171
6172
6173
6174
6175
6176
6177
6178
6179
6180
6181
6182
6183
6184
6185
6186
6187
6188
6189
6190
6191
6192
6193
6194
6195
6196
6197
6198
6199
6200
6201
6202
6203
6204
6205
6206
6207
6208
6209
6210
6211
6212
6213
6214
6215
6216
6217
6218
6219
6220
6221
6222
6223
6224
6225
6226
6227
6228
6229
6230
6231
6232
6233
6234
6235
6236
6237
6238
6239
6240
6241
6242
6243
6244
6245
6246
6247
6248
6249
6250
6251
6252
6253
6254
6255
6256
6257
6258
6259
6260
6261
6262
6263
6264
6265
6266
6267
6268
6269
6270
6271
6272
6273
6274
6275
6276
6277
6278
6279
6280
6281
6282
6283
6284
6285
6286
6287
6288
6289
6290
6291
6292
6293
6294
6295
6296
6297
6298
6299
6300
6301
6302
6303
6304
6305
6306
6307
6308
6309
6310
6311
6312
6313
6314
6315
6316
6317
6318
6319
6320
6321
6322
6323
6324
6325
6326
6327
6328
6329
6330
6331
6332
6333
6334
6335
6336
6337
6338
6339
6340
6341
6342
6343
6344
6345
6346
6347
6348
6349
6350
6351
6352
6353
6354
6355
6356
6357
6358
6359
6360
6361
6362
6363
6364
6365
6366
6367
6368
6369
6370
6371
6372
6373
6374
6375
6376
6377
6378
6379
6380
6381
6382
6383
6384
6385
6386
6387
6388
6389
6390
6391
6392
6393
6394
6395
6396
6397
6398
6399
6400
6401
6402
6403
6404
6405
6406
6407
6408
6409
6410
6411
6412
6413
6414
6415
6416
6417
6418
6419
6420
6421
6422
6423
6424
6425
6426
6427
6428
6429
6430
6431
6432
6433
6434
6435
6436
6437
6438
6439
6440
6441
6442
6443
6444
6445
6446
6447
6448
6449
6450
6451
6452
6453
6454
6455
6456
6457
6458
6459
6460
6461
6462
6463
6464
6465
6466
6467
6468
6469
6470
6471
6472
6473
6474
6475
6476
6477
6478
6479
6480
6481
6482
6483
6484
6485
6486
6487
6488
6489
6490
6491
6492
6493
6494
6495
6496
6497
6498
6499
6500
6501
6502
6503
6504
6505
6506
6507
6508
6509
6510
6511
6512
6513
6514
6515
6516
6517
6518
6519
6520
6521
6522
6523
6524
6525
6526
6527
6528
6529
6530
6531
6532
6533
6534
6535
6536
6537
6538
6539
6540
6541
6542
6543
6544
6545
6546
6547
6548
6549
6550
6551
6552
6553
6554
6555
6556
6557
6558
6559
6560
6561
6562
6563
6564
6565
6566
6567
6568
6569
6570
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_opengl.h
 *  This is a simple file to encapsulate the OpenGL API headers
 */

#include "SDL_config.h"

#ifdef __WIN32__
#define WIN32_LEAN_AND_MEAN
#ifndef NOMINMAX
#define NOMINMAX	/* Don't defined min() and max() */
#endif
#include <windows.h>
#endif
#ifndef NO_SDL_GLEXT
#define __glext_h_  /* Don't let gl.h include glext.h */
#endif
#if defined(__MACOSX__)
#include <OpenGL/gl.h>	/* Header File For The OpenGL Library */
#include <OpenGL/glu.h>	/* Header File For The GLU Library */
#elif defined(__MACOS__)
#include <gl.h>		/* Header File For The OpenGL Library */
#include <glu.h>	/* Header File For The GLU Library */
#else
#include <GL/gl.h>	/* Header File For The OpenGL Library */
#include <GL/glu.h>	/* Header File For The GLU Library */
#endif
#ifndef NO_SDL_GLEXT
#undef __glext_h_
#endif

/** @name GLext.h
 *  This file taken from "GLext.h" from the Jeff Molofee OpenGL tutorials.
 *  It is included here because glext.h is not available on some systems.
 *  If you don't want this version included, simply define "NO_SDL_GLEXT"
 */
/*@{*/
#ifndef NO_SDL_GLEXT
#if !defined(__glext_h_) && !defined(GL_GLEXT_LEGACY)
#define __glext_h_

#ifdef __cplusplus
extern "C" {
#endif

/*
** License Applicability. Except to the extent portions of this file are
** made subject to an alternative license as permitted in the SGI Free
** Software License B, Version 1.1 (the "License"), the contents of this
** file are subject only to the provisions of the License. You may not use
** this file except in compliance with the License. You may obtain a copy
** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
** 
** http://oss.sgi.com/projects/FreeB
** 
** Note that, as provided in the License, the Software is distributed on an
** "AS IS" basis, with ALL EXPRESS AND IMPLIED WARRANTIES AND CONDITIONS
** DISCLAIMED, INCLUDING, WITHOUT LIMITATION, ANY IMPLIED WARRANTIES AND
** CONDITIONS OF MERCHANTABILITY, SATISFACTORY QUALITY, FITNESS FOR A
** PARTICULAR PURPOSE, AND NON-INFRINGEMENT.
** 
** Original Code. The Original Code is: OpenGL Sample Implementation,
** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
** Inc. The Original Code is Copyright (c) 1991-2004 Silicon Graphics, Inc.
** Copyright in any portions created by third parties is as indicated
** elsewhere herein. All Rights Reserved.
** 
** Additional Notice Provisions: This software was created using the
** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
** not been independently verified as being compliant with the OpenGL(R)
** version 1.2.1 Specification.
*/

#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__)
#define WIN32_LEAN_AND_MEAN 1
#include <windows.h>
#endif

#ifndef APIENTRY
#define APIENTRY
#endif
#ifndef APIENTRYP
#define APIENTRYP APIENTRY *
#endif
#ifndef GLAPI
#define GLAPI extern
#endif

/*************************************************************/

/* Header file version number, required by OpenGL ABI for Linux */
/* glext.h last updated 2005/06/20 */
/* Current version at http://oss.sgi.com/projects/ogl-sample/registry/ */
#define GL_GLEXT_VERSION 29

#ifndef GL_VERSION_1_2
#define GL_UNSIGNED_BYTE_3_3_2            0x8032
#define GL_UNSIGNED_SHORT_4_4_4_4         0x8033
#define GL_UNSIGNED_SHORT_5_5_5_1         0x8034
#define GL_UNSIGNED_INT_8_8_8_8           0x8035
#define GL_UNSIGNED_INT_10_10_10_2        0x8036
#define GL_RESCALE_NORMAL                 0x803A
#define GL_TEXTURE_BINDING_3D             0x806A
#define GL_PACK_SKIP_IMAGES               0x806B
#define GL_PACK_IMAGE_HEIGHT              0x806C
#define GL_UNPACK_SKIP_IMAGES             0x806D
#define GL_UNPACK_IMAGE_HEIGHT            0x806E
#define GL_TEXTURE_3D                     0x806F
#define GL_PROXY_TEXTURE_3D               0x8070
#define GL_TEXTURE_DEPTH                  0x8071
#define GL_TEXTURE_WRAP_R                 0x8072
#define GL_MAX_3D_TEXTURE_SIZE            0x8073
#define GL_UNSIGNED_BYTE_2_3_3_REV        0x8362
#define GL_UNSIGNED_SHORT_5_6_5           0x8363
#define GL_UNSIGNED_SHORT_5_6_5_REV       0x8364
#define GL_UNSIGNED_SHORT_4_4_4_4_REV     0x8365
#define GL_UNSIGNED_SHORT_1_5_5_5_REV     0x8366
#define GL_UNSIGNED_INT_8_8_8_8_REV       0x8367
#define GL_UNSIGNED_INT_2_10_10_10_REV    0x8368
#define GL_BGR                            0x80E0
#define GL_BGRA                           0x80E1
#define GL_MAX_ELEMENTS_VERTICES          0x80E8
#define GL_MAX_ELEMENTS_INDICES           0x80E9
#define GL_CLAMP_TO_EDGE                  0x812F
#define GL_TEXTURE_MIN_LOD                0x813A
#define GL_TEXTURE_MAX_LOD                0x813B
#define GL_TEXTURE_BASE_LEVEL             0x813C
#define GL_TEXTURE_MAX_LEVEL              0x813D
#define GL_LIGHT_MODEL_COLOR_CONTROL      0x81F8
#define GL_SINGLE_COLOR                   0x81F9
#define GL_SEPARATE_SPECULAR_COLOR        0x81FA
#define GL_SMOOTH_POINT_SIZE_RANGE        0x0B12
#define GL_SMOOTH_POINT_SIZE_GRANULARITY  0x0B13
#define GL_SMOOTH_LINE_WIDTH_RANGE        0x0B22
#define GL_SMOOTH_LINE_WIDTH_GRANULARITY  0x0B23
#define GL_ALIASED_POINT_SIZE_RANGE       0x846D
#define GL_ALIASED_LINE_WIDTH_RANGE       0x846E
#endif

#ifndef GL_ARB_imaging
#define GL_CONSTANT_COLOR                 0x8001
#define GL_ONE_MINUS_CONSTANT_COLOR       0x8002
#define GL_CONSTANT_ALPHA                 0x8003
#define GL_ONE_MINUS_CONSTANT_ALPHA       0x8004
#define GL_BLEND_COLOR                    0x8005
#define GL_FUNC_ADD                       0x8006
#define GL_MIN                            0x8007
#define GL_MAX                            0x8008
#define GL_BLEND_EQUATION                 0x8009
#define GL_FUNC_SUBTRACT                  0x800A
#define GL_FUNC_REVERSE_SUBTRACT          0x800B
#define GL_CONVOLUTION_1D                 0x8010
#define GL_CONVOLUTION_2D                 0x8011
#define GL_SEPARABLE_2D                   0x8012
#define GL_CONVOLUTION_BORDER_MODE        0x8013
#define GL_CONVOLUTION_FILTER_SCALE       0x8014
#define GL_CONVOLUTION_FILTER_BIAS        0x8015
#define GL_REDUCE                         0x8016
#define GL_CONVOLUTION_FORMAT             0x8017
#define GL_CONVOLUTION_WIDTH              0x8018
#define GL_CONVOLUTION_HEIGHT             0x8019
#define GL_MAX_CONVOLUTION_WIDTH          0x801A
#define GL_MAX_CONVOLUTION_HEIGHT         0x801B
#define GL_POST_CONVOLUTION_RED_SCALE     0x801C
#define GL_POST_CONVOLUTION_GREEN_SCALE   0x801D
#define GL_POST_CONVOLUTION_BLUE_SCALE    0x801E
#define GL_POST_CONVOLUTION_ALPHA_SCALE   0x801F
#define GL_POST_CONVOLUTION_RED_BIAS      0x8020
#define GL_POST_CONVOLUTION_GREEN_BIAS    0x8021
#define GL_POST_CONVOLUTION_BLUE_BIAS     0x8022
#define GL_POST_CONVOLUTION_ALPHA_BIAS    0x8023
#define GL_HISTOGRAM                      0x8024
#define GL_PROXY_HISTOGRAM                0x8025
#define GL_HISTOGRAM_WIDTH                0x8026
#define GL_HISTOGRAM_FORMAT               0x8027
#define GL_HISTOGRAM_RED_SIZE             0x8028
#define GL_HISTOGRAM_GREEN_SIZE           0x8029
#define GL_HISTOGRAM_BLUE_SIZE            0x802A
#define GL_HISTOGRAM_ALPHA_SIZE           0x802B
#define GL_HISTOGRAM_LUMINANCE_SIZE       0x802C
#define GL_HISTOGRAM_SINK                 0x802D
#define GL_MINMAX                         0x802E
#define GL_MINMAX_FORMAT                  0x802F
#define GL_MINMAX_SINK                    0x8030
#define GL_TABLE_TOO_LARGE                0x8031
#define GL_COLOR_MATRIX                   0x80B1
#define GL_COLOR_MATRIX_STACK_DEPTH       0x80B2
#define GL_MAX_COLOR_MATRIX_STACK_DEPTH   0x80B3
#define GL_POST_COLOR_MATRIX_RED_SCALE    0x80B4
#define GL_POST_COLOR_MATRIX_GREEN_SCALE  0x80B5
#define GL_POST_COLOR_MATRIX_BLUE_SCALE   0x80B6
#define GL_POST_COLOR_MATRIX_ALPHA_SCALE  0x80B7
#define GL_POST_COLOR_MATRIX_RED_BIAS     0x80B8
#define GL_POST_COLOR_MATRIX_GREEN_BIAS   0x80B9
#define GL_POST_COLOR_MATRIX_BLUE_BIAS    0x80BA
#define GL_POST_COLOR_MATRIX_ALPHA_BIAS   0x80BB
#define GL_COLOR_TABLE                    0x80D0
#define GL_POST_CONVOLUTION_COLOR_TABLE   0x80D1
#define GL_POST_COLOR_MATRIX_COLOR_TABLE  0x80D2
#define GL_PROXY_COLOR_TABLE              0x80D3
#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4
#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5
#define GL_COLOR_TABLE_SCALE              0x80D6
#define GL_COLOR_TABLE_BIAS               0x80D7
#define GL_COLOR_TABLE_FORMAT             0x80D8
#define GL_COLOR_TABLE_WIDTH              0x80D9
#define GL_COLOR_TABLE_RED_SIZE           0x80DA
#define GL_COLOR_TABLE_GREEN_SIZE         0x80DB
#define GL_COLOR_TABLE_BLUE_SIZE          0x80DC
#define GL_COLOR_TABLE_ALPHA_SIZE         0x80DD
#define GL_COLOR_TABLE_LUMINANCE_SIZE     0x80DE
#define GL_COLOR_TABLE_INTENSITY_SIZE     0x80DF
#define GL_CONSTANT_BORDER                0x8151
#define GL_REPLICATE_BORDER               0x8153
#define GL_CONVOLUTION_BORDER_COLOR       0x8154
#endif

#ifndef GL_VERSION_1_3
#define GL_TEXTURE0                       0x84C0
#define GL_TEXTURE1                       0x84C1
#define GL_TEXTURE2                       0x84C2
#define GL_TEXTURE3                       0x84C3
#define GL_TEXTURE4                       0x84C4
#define GL_TEXTURE5                       0x84C5
#define GL_TEXTURE6                       0x84C6
#define GL_TEXTURE7                       0x84C7
#define GL_TEXTURE8                       0x84C8
#define GL_TEXTURE9                       0x84C9
#define GL_TEXTURE10                      0x84CA
#define GL_TEXTURE11                      0x84CB
#define GL_TEXTURE12                      0x84CC
#define GL_TEXTURE13                      0x84CD
#define GL_TEXTURE14                      0x84CE
#define GL_TEXTURE15                      0x84CF
#define GL_TEXTURE16                      0x84D0
#define GL_TEXTURE17                      0x84D1
#define GL_TEXTURE18                      0x84D2
#define GL_TEXTURE19                      0x84D3
#define GL_TEXTURE20                      0x84D4
#define GL_TEXTURE21                      0x84D5
#define GL_TEXTURE22                      0x84D6
#define GL_TEXTURE23                      0x84D7
#define GL_TEXTURE24                      0x84D8
#define GL_TEXTURE25                      0x84D9
#define GL_TEXTURE26                      0x84DA
#define GL_TEXTURE27                      0x84DB
#define GL_TEXTURE28                      0x84DC
#define GL_TEXTURE29                      0x84DD
#define GL_TEXTURE30                      0x84DE
#define GL_TEXTURE31                      0x84DF
#define GL_ACTIVE_TEXTURE                 0x84E0
#define GL_CLIENT_ACTIVE_TEXTURE          0x84E1
#define GL_MAX_TEXTURE_UNITS              0x84E2
#define GL_TRANSPOSE_MODELVIEW_MATRIX     0x84E3
#define GL_TRANSPOSE_PROJECTION_MATRIX    0x84E4
#define GL_TRANSPOSE_TEXTURE_MATRIX       0x84E5
#define GL_TRANSPOSE_COLOR_MATRIX         0x84E6
#define GL_MULTISAMPLE                    0x809D
#define GL_SAMPLE_ALPHA_TO_COVERAGE       0x809E
#define GL_SAMPLE_ALPHA_TO_ONE            0x809F
#define GL_SAMPLE_COVERAGE                0x80A0
#define GL_SAMPLE_BUFFERS                 0x80A8
#define GL_SAMPLES                        0x80A9
#define GL_SAMPLE_COVERAGE_VALUE          0x80AA
#define GL_SAMPLE_COVERAGE_INVERT         0x80AB
#define GL_MULTISAMPLE_BIT                0x20000000
#define GL_NORMAL_MAP                     0x8511
#define GL_REFLECTION_MAP                 0x8512
#define GL_TEXTURE_CUBE_MAP               0x8513
#define GL_TEXTURE_BINDING_CUBE_MAP       0x8514
#define GL_TEXTURE_CUBE_MAP_POSITIVE_X    0x8515
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X    0x8516
#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y    0x8517
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y    0x8518
#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z    0x8519
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z    0x851A
#define GL_PROXY_TEXTURE_CUBE_MAP         0x851B
#define GL_MAX_CUBE_MAP_TEXTURE_SIZE      0x851C
#define GL_COMPRESSED_ALPHA               0x84E9
#define GL_COMPRESSED_LUMINANCE           0x84EA
#define GL_COMPRESSED_LUMINANCE_ALPHA     0x84EB
#define GL_COMPRESSED_INTENSITY           0x84EC
#define GL_COMPRESSED_RGB                 0x84ED
#define GL_COMPRESSED_RGBA                0x84EE
#define GL_TEXTURE_COMPRESSION_HINT       0x84EF
#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE  0x86A0
#define GL_TEXTURE_COMPRESSED             0x86A1
#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2
#define GL_COMPRESSED_TEXTURE_FORMATS     0x86A3
#define GL_CLAMP_TO_BORDER                0x812D
#define GL_COMBINE                        0x8570
#define GL_COMBINE_RGB                    0x8571
#define GL_COMBINE_ALPHA                  0x8572
#define GL_SOURCE0_RGB                    0x8580
#define GL_SOURCE1_RGB                    0x8581
#define GL_SOURCE2_RGB                    0x8582
#define GL_SOURCE0_ALPHA                  0x8588
#define GL_SOURCE1_ALPHA                  0x8589
#define GL_SOURCE2_ALPHA                  0x858A
#define GL_OPERAND0_RGB                   0x8590
#define GL_OPERAND1_RGB                   0x8591
#define GL_OPERAND2_RGB                   0x8592
#define GL_OPERAND0_ALPHA                 0x8598
#define GL_OPERAND1_ALPHA                 0x8599
#define GL_OPERAND2_ALPHA                 0x859A
#define GL_RGB_SCALE                      0x8573
#define GL_ADD_SIGNED                     0x8574
#define GL_INTERPOLATE                    0x8575
#define GL_SUBTRACT                       0x84E7
#define GL_CONSTANT                       0x8576
#define GL_PRIMARY_COLOR                  0x8577
#define GL_PREVIOUS                       0x8578
#define GL_DOT3_RGB                       0x86AE
#define GL_DOT3_RGBA                      0x86AF
#endif

#ifndef GL_VERSION_1_4
#define GL_BLEND_DST_RGB                  0x80C8
#define GL_BLEND_SRC_RGB                  0x80C9
#define GL_BLEND_DST_ALPHA                0x80CA
#define GL_BLEND_SRC_ALPHA                0x80CB
#define GL_POINT_SIZE_MIN                 0x8126
#define GL_POINT_SIZE_MAX                 0x8127
#define GL_POINT_FADE_THRESHOLD_SIZE      0x8128
#define GL_POINT_DISTANCE_ATTENUATION     0x8129
#define GL_GENERATE_MIPMAP                0x8191
#define GL_GENERATE_MIPMAP_HINT           0x8192
#define GL_DEPTH_COMPONENT16              0x81A5
#define GL_DEPTH_COMPONENT24              0x81A6
#define GL_DEPTH_COMPONENT32              0x81A7
#define GL_MIRRORED_REPEAT                0x8370
#define GL_FOG_COORDINATE_SOURCE          0x8450
#define GL_FOG_COORDINATE                 0x8451
#define GL_FRAGMENT_DEPTH                 0x8452
#define GL_CURRENT_FOG_COORDINATE         0x8453
#define GL_FOG_COORDINATE_ARRAY_TYPE      0x8454
#define GL_FOG_COORDINATE_ARRAY_STRIDE    0x8455
#define GL_FOG_COORDINATE_ARRAY_POINTER   0x8456
#define GL_FOG_COORDINATE_ARRAY           0x8457
#define GL_COLOR_SUM                      0x8458
#define GL_CURRENT_SECONDARY_COLOR        0x8459
#define GL_SECONDARY_COLOR_ARRAY_SIZE     0x845A
#define GL_SECONDARY_COLOR_ARRAY_TYPE     0x845B
#define GL_SECONDARY_COLOR_ARRAY_STRIDE   0x845C
#define GL_SECONDARY_COLOR_ARRAY_POINTER  0x845D
#define GL_SECONDARY_COLOR_ARRAY          0x845E
#define GL_MAX_TEXTURE_LOD_BIAS           0x84FD
#define GL_TEXTURE_FILTER_CONTROL         0x8500
#define GL_TEXTURE_LOD_BIAS               0x8501
#define GL_INCR_WRAP                      0x8507
#define GL_DECR_WRAP                      0x8508
#define GL_TEXTURE_DEPTH_SIZE             0x884A
#define GL_DEPTH_TEXTURE_MODE             0x884B
#define GL_TEXTURE_COMPARE_MODE           0x884C
#define GL_TEXTURE_COMPARE_FUNC           0x884D
#define GL_COMPARE_R_TO_TEXTURE           0x884E
#endif

#ifndef GL_VERSION_1_5
#define GL_BUFFER_SIZE                    0x8764
#define GL_BUFFER_USAGE                   0x8765
#define GL_QUERY_COUNTER_BITS             0x8864
#define GL_CURRENT_QUERY                  0x8865
#define GL_QUERY_RESULT                   0x8866
#define GL_QUERY_RESULT_AVAILABLE         0x8867
#define GL_ARRAY_BUFFER                   0x8892
#define GL_ELEMENT_ARRAY_BUFFER           0x8893
#define GL_ARRAY_BUFFER_BINDING           0x8894
#define GL_ELEMENT_ARRAY_BUFFER_BINDING   0x8895
#define GL_VERTEX_ARRAY_BUFFER_BINDING    0x8896
#define GL_NORMAL_ARRAY_BUFFER_BINDING    0x8897
#define GL_COLOR_ARRAY_BUFFER_BINDING     0x8898
#define GL_INDEX_ARRAY_BUFFER_BINDING     0x8899
#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A
#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B
#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C
#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D
#define GL_WEIGHT_ARRAY_BUFFER_BINDING    0x889E
#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F
#define GL_READ_ONLY                      0x88B8
#define GL_WRITE_ONLY                     0x88B9
#define GL_READ_WRITE                     0x88BA
#define GL_BUFFER_ACCESS                  0x88BB
#define GL_BUFFER_MAPPED                  0x88BC
#define GL_BUFFER_MAP_POINTER             0x88BD
#define GL_STREAM_DRAW                    0x88E0
#define GL_STREAM_READ                    0x88E1
#define GL_STREAM_COPY                    0x88E2
#define GL_STATIC_DRAW                    0x88E4
#define GL_STATIC_READ                    0x88E5
#define GL_STATIC_COPY                    0x88E6
#define GL_DYNAMIC_DRAW                   0x88E8
#define GL_DYNAMIC_READ                   0x88E9
#define GL_DYNAMIC_COPY                   0x88EA
#define GL_SAMPLES_PASSED                 0x8914
#define GL_FOG_COORD_SRC                  GL_FOG_COORDINATE_SOURCE
#define GL_FOG_COORD                      GL_FOG_COORDINATE
#define GL_CURRENT_FOG_COORD              GL_CURRENT_FOG_COORDINATE
#define GL_FOG_COORD_ARRAY_TYPE           GL_FOG_COORDINATE_ARRAY_TYPE
#define GL_FOG_COORD_ARRAY_STRIDE         GL_FOG_COORDINATE_ARRAY_STRIDE
#define GL_FOG_COORD_ARRAY_POINTER        GL_FOG_COORDINATE_ARRAY_POINTER
#define GL_FOG_COORD_ARRAY                GL_FOG_COORDINATE_ARRAY
#define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING
#define GL_SRC0_RGB                       GL_SOURCE0_RGB
#define GL_SRC1_RGB                       GL_SOURCE1_RGB
#define GL_SRC2_RGB                       GL_SOURCE2_RGB
#define GL_SRC0_ALPHA                     GL_SOURCE0_ALPHA
#define GL_SRC1_ALPHA                     GL_SOURCE1_ALPHA
#define GL_SRC2_ALPHA                     GL_SOURCE2_ALPHA
#endif

#ifndef GL_VERSION_2_0
#define GL_BLEND_EQUATION_RGB             GL_BLEND_EQUATION
#define GL_VERTEX_ATTRIB_ARRAY_ENABLED    0x8622
#define GL_VERTEX_ATTRIB_ARRAY_SIZE       0x8623
#define GL_VERTEX_ATTRIB_ARRAY_STRIDE     0x8624
#define GL_VERTEX_ATTRIB_ARRAY_TYPE       0x8625
#define GL_CURRENT_VERTEX_ATTRIB          0x8626
#define GL_VERTEX_PROGRAM_POINT_SIZE      0x8642
#define GL_VERTEX_PROGRAM_TWO_SIDE        0x8643
#define GL_VERTEX_ATTRIB_ARRAY_POINTER    0x8645
#define GL_STENCIL_BACK_FUNC              0x8800
#define GL_STENCIL_BACK_FAIL              0x8801
#define GL_STENCIL_BACK_PASS_DEPTH_FAIL   0x8802
#define GL_STENCIL_BACK_PASS_DEPTH_PASS   0x8803
#define GL_MAX_DRAW_BUFFERS               0x8824
#define GL_DRAW_BUFFER0                   0x8825
#define GL_DRAW_BUFFER1                   0x8826
#define GL_DRAW_BUFFER2                   0x8827
#define GL_DRAW_BUFFER3                   0x8828
#define GL_DRAW_BUFFER4                   0x8829
#define GL_DRAW_BUFFER5                   0x882A
#define GL_DRAW_BUFFER6                   0x882B
#define GL_DRAW_BUFFER7                   0x882C
#define GL_DRAW_BUFFER8                   0x882D
#define GL_DRAW_BUFFER9                   0x882E
#define GL_DRAW_BUFFER10                  0x882F
#define GL_DRAW_BUFFER11                  0x8830
#define GL_DRAW_BUFFER12                  0x8831
#define GL_DRAW_BUFFER13                  0x8832
#define GL_DRAW_BUFFER14                  0x8833
#define GL_DRAW_BUFFER15                  0x8834
#define GL_BLEND_EQUATION_ALPHA           0x883D
#define GL_POINT_SPRITE                   0x8861
#define GL_COORD_REPLACE                  0x8862
#define GL_MAX_VERTEX_ATTRIBS             0x8869
#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A
#define GL_MAX_TEXTURE_COORDS             0x8871
#define GL_MAX_TEXTURE_IMAGE_UNITS        0x8872
#define GL_FRAGMENT_SHADER                0x8B30
#define GL_VERTEX_SHADER                  0x8B31
#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49
#define GL_MAX_VERTEX_UNIFORM_COMPONENTS  0x8B4A
#define GL_MAX_VARYING_FLOATS             0x8B4B
#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C
#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D
#define GL_SHADER_TYPE                    0x8B4F
#define GL_FLOAT_VEC2                     0x8B50
#define GL_FLOAT_VEC3                     0x8B51
#define GL_FLOAT_VEC4                     0x8B52
#define GL_INT_VEC2                       0x8B53
#define GL_INT_VEC3                       0x8B54
#define GL_INT_VEC4                       0x8B55
#define GL_BOOL                           0x8B56
#define GL_BOOL_VEC2                      0x8B57
#define GL_BOOL_VEC3                      0x8B58
#define GL_BOOL_VEC4                      0x8B59
#define GL_FLOAT_MAT2                     0x8B5A
#define GL_FLOAT_MAT3                     0x8B5B
#define GL_FLOAT_MAT4                     0x8B5C
#define GL_SAMPLER_1D                     0x8B5D
#define GL_SAMPLER_2D                     0x8B5E
#define GL_SAMPLER_3D                     0x8B5F
#define GL_SAMPLER_CUBE                   0x8B60
#define GL_SAMPLER_1D_SHADOW              0x8B61
#define GL_SAMPLER_2D_SHADOW              0x8B62
#define GL_DELETE_STATUS                  0x8B80
#define GL_COMPILE_STATUS                 0x8B81
#define GL_LINK_STATUS                    0x8B82
#define GL_VALIDATE_STATUS                0x8B83
#define GL_INFO_LOG_LENGTH                0x8B84
#define GL_ATTACHED_SHADERS               0x8B85
#define GL_ACTIVE_UNIFORMS                0x8B86
#define GL_ACTIVE_UNIFORM_MAX_LENGTH      0x8B87
#define GL_SHADER_SOURCE_LENGTH           0x8B88
#define GL_ACTIVE_ATTRIBUTES              0x8B89
#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH    0x8B8A
#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B
#define GL_SHADING_LANGUAGE_VERSION       0x8B8C
#define GL_CURRENT_PROGRAM                0x8B8D
#define GL_POINT_SPRITE_COORD_ORIGIN      0x8CA0
#define GL_LOWER_LEFT                     0x8CA1
#define GL_UPPER_LEFT                     0x8CA2
#define GL_STENCIL_BACK_REF               0x8CA3
#define GL_STENCIL_BACK_VALUE_MASK        0x8CA4
#define GL_STENCIL_BACK_WRITEMASK         0x8CA5
#endif

#ifndef GL_ARB_multitexture
#define GL_TEXTURE0_ARB                   0x84C0
#define GL_TEXTURE1_ARB                   0x84C1
#define GL_TEXTURE2_ARB                   0x84C2
#define GL_TEXTURE3_ARB                   0x84C3
#define GL_TEXTURE4_ARB                   0x84C4
#define GL_TEXTURE5_ARB                   0x84C5
#define GL_TEXTURE6_ARB                   0x84C6
#define GL_TEXTURE7_ARB                   0x84C7
#define GL_TEXTURE8_ARB                   0x84C8
#define GL_TEXTURE9_ARB                   0x84C9
#define GL_TEXTURE10_ARB                  0x84CA
#define GL_TEXTURE11_ARB                  0x84CB
#define GL_TEXTURE12_ARB                  0x84CC
#define GL_TEXTURE13_ARB                  0x84CD
#define GL_TEXTURE14_ARB                  0x84CE
#define GL_TEXTURE15_ARB                  0x84CF
#define GL_TEXTURE16_ARB                  0x84D0
#define GL_TEXTURE17_ARB                  0x84D1
#define GL_TEXTURE18_ARB                  0x84D2
#define GL_TEXTURE19_ARB                  0x84D3
#define GL_TEXTURE20_ARB                  0x84D4
#define GL_TEXTURE21_ARB                  0x84D5
#define GL_TEXTURE22_ARB                  0x84D6
#define GL_TEXTURE23_ARB                  0x84D7
#define GL_TEXTURE24_ARB                  0x84D8
#define GL_TEXTURE25_ARB                  0x84D9
#define GL_TEXTURE26_ARB                  0x84DA
#define GL_TEXTURE27_ARB                  0x84DB
#define GL_TEXTURE28_ARB                  0x84DC
#define GL_TEXTURE29_ARB                  0x84DD
#define GL_TEXTURE30_ARB                  0x84DE
#define GL_TEXTURE31_ARB                  0x84DF
#define GL_ACTIVE_TEXTURE_ARB             0x84E0
#define GL_CLIENT_ACTIVE_TEXTURE_ARB      0x84E1
#define GL_MAX_TEXTURE_UNITS_ARB          0x84E2
#endif

#ifndef GL_ARB_transpose_matrix
#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3
#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4
#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB   0x84E5
#define GL_TRANSPOSE_COLOR_MATRIX_ARB     0x84E6
#endif

#ifndef GL_ARB_multisample
#define GL_MULTISAMPLE_ARB                0x809D
#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB   0x809E
#define GL_SAMPLE_ALPHA_TO_ONE_ARB        0x809F
#define GL_SAMPLE_COVERAGE_ARB            0x80A0
#define GL_SAMPLE_BUFFERS_ARB             0x80A8
#define GL_SAMPLES_ARB                    0x80A9
#define GL_SAMPLE_COVERAGE_VALUE_ARB      0x80AA
#define GL_SAMPLE_COVERAGE_INVERT_ARB     0x80AB
#define GL_MULTISAMPLE_BIT_ARB            0x20000000
#endif

#ifndef GL_ARB_texture_env_add
#endif

#ifndef GL_ARB_texture_cube_map
#define GL_NORMAL_MAP_ARB                 0x8511
#define GL_REFLECTION_MAP_ARB             0x8512
#define GL_TEXTURE_CUBE_MAP_ARB           0x8513
#define GL_TEXTURE_BINDING_CUBE_MAP_ARB   0x8514
#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516
#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518
#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A
#define GL_PROXY_TEXTURE_CUBE_MAP_ARB     0x851B
#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB  0x851C
#endif

#ifndef GL_ARB_texture_compression
#define GL_COMPRESSED_ALPHA_ARB           0x84E9
#define GL_COMPRESSED_LUMINANCE_ARB       0x84EA
#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB
#define GL_COMPRESSED_INTENSITY_ARB       0x84EC
#define GL_COMPRESSED_RGB_ARB             0x84ED
#define GL_COMPRESSED_RGBA_ARB            0x84EE
#define GL_TEXTURE_COMPRESSION_HINT_ARB   0x84EF
#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0
#define GL_TEXTURE_COMPRESSED_ARB         0x86A1
#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2
#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3
#endif

#ifndef GL_ARB_texture_border_clamp
#define GL_CLAMP_TO_BORDER_ARB            0x812D
#endif

#ifndef GL_ARB_point_parameters
#define GL_POINT_SIZE_MIN_ARB             0x8126
#define GL_POINT_SIZE_MAX_ARB             0x8127
#define GL_POINT_FADE_THRESHOLD_SIZE_ARB  0x8128
#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129
#endif

#ifndef GL_ARB_vertex_blend
#define GL_MAX_VERTEX_UNITS_ARB           0x86A4
#define GL_ACTIVE_VERTEX_UNITS_ARB        0x86A5
#define GL_WEIGHT_SUM_UNITY_ARB           0x86A6
#define GL_VERTEX_BLEND_ARB               0x86A7
#define GL_CURRENT_WEIGHT_ARB             0x86A8
#define GL_WEIGHT_ARRAY_TYPE_ARB          0x86A9
#define GL_WEIGHT_ARRAY_STRIDE_ARB        0x86AA
#define GL_WEIGHT_ARRAY_SIZE_ARB          0x86AB
#define GL_WEIGHT_ARRAY_POINTER_ARB       0x86AC
#define GL_WEIGHT_ARRAY_ARB               0x86AD
#define GL_MODELVIEW0_ARB                 0x1700
#define GL_MODELVIEW1_ARB                 0x850A
#define GL_MODELVIEW2_ARB                 0x8722
#define GL_MODELVIEW3_ARB                 0x8723
#define GL_MODELVIEW4_ARB                 0x8724
#define GL_MODELVIEW5_ARB                 0x8725
#define GL_MODELVIEW6_ARB                 0x8726
#define GL_MODELVIEW7_ARB                 0x8727
#define GL_MODELVIEW8_ARB                 0x8728
#define GL_MODELVIEW9_ARB                 0x8729
#define GL_MODELVIEW10_ARB                0x872A
#define GL_MODELVIEW11_ARB                0x872B
#define GL_MODELVIEW12_ARB                0x872C
#define GL_MODELVIEW13_ARB                0x872D
#define GL_MODELVIEW14_ARB                0x872E
#define GL_MODELVIEW15_ARB                0x872F
#define GL_MODELVIEW16_ARB                0x8730
#define GL_MODELVIEW17_ARB                0x8731
#define GL_MODELVIEW18_ARB                0x8732
#define GL_MODELVIEW19_ARB                0x8733
#define GL_MODELVIEW20_ARB                0x8734
#define GL_MODELVIEW21_ARB                0x8735
#define GL_MODELVIEW22_ARB                0x8736
#define GL_MODELVIEW23_ARB                0x8737
#define GL_MODELVIEW24_ARB                0x8738
#define GL_MODELVIEW25_ARB                0x8739
#define GL_MODELVIEW26_ARB                0x873A
#define GL_MODELVIEW27_ARB                0x873B
#define GL_MODELVIEW28_ARB                0x873C
#define GL_MODELVIEW29_ARB                0x873D
#define GL_MODELVIEW30_ARB                0x873E
#define GL_MODELVIEW31_ARB                0x873F
#endif

#ifndef GL_ARB_matrix_palette
#define GL_MATRIX_PALETTE_ARB             0x8840
#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841
#define GL_MAX_PALETTE_MATRICES_ARB       0x8842
#define GL_CURRENT_PALETTE_MATRIX_ARB     0x8843
#define GL_MATRIX_INDEX_ARRAY_ARB         0x8844
#define GL_CURRENT_MATRIX_INDEX_ARB       0x8845
#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB    0x8846
#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB    0x8847
#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB  0x8848
#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849
#endif

#ifndef GL_ARB_texture_env_combine
#define GL_COMBINE_ARB                    0x8570
#define GL_COMBINE_RGB_ARB                0x8571
#define GL_COMBINE_ALPHA_ARB              0x8572
#define GL_SOURCE0_RGB_ARB                0x8580
#define GL_SOURCE1_RGB_ARB                0x8581
#define GL_SOURCE2_RGB_ARB                0x8582
#define GL_SOURCE0_ALPHA_ARB              0x8588
#define GL_SOURCE1_ALPHA_ARB              0x8589
#define GL_SOURCE2_ALPHA_ARB              0x858A
#define GL_OPERAND0_RGB_ARB               0x8590
#define GL_OPERAND1_RGB_ARB               0x8591
#define GL_OPERAND2_RGB_ARB               0x8592
#define GL_OPERAND0_ALPHA_ARB             0x8598
#define GL_OPERAND1_ALPHA_ARB             0x8599
#define GL_OPERAND2_ALPHA_ARB             0x859A
#define GL_RGB_SCALE_ARB                  0x8573
#define GL_ADD_SIGNED_ARB                 0x8574
#define GL_INTERPOLATE_ARB                0x8575
#define GL_SUBTRACT_ARB                   0x84E7
#define GL_CONSTANT_ARB                   0x8576
#define GL_PRIMARY_COLOR_ARB              0x8577
#define GL_PREVIOUS_ARB                   0x8578
#endif

#ifndef GL_ARB_texture_env_crossbar
#endif

#ifndef GL_ARB_texture_env_dot3
#define GL_DOT3_RGB_ARB                   0x86AE
#define GL_DOT3_RGBA_ARB                  0x86AF
#endif

#ifndef GL_ARB_texture_mirrored_repeat
#define GL_MIRRORED_REPEAT_ARB            0x8370
#endif

#ifndef GL_ARB_depth_texture
#define GL_DEPTH_COMPONENT16_ARB          0x81A5
#define GL_DEPTH_COMPONENT24_ARB          0x81A6
#define GL_DEPTH_COMPONENT32_ARB          0x81A7
#define GL_TEXTURE_DEPTH_SIZE_ARB         0x884A
#define GL_DEPTH_TEXTURE_MODE_ARB         0x884B
#endif

#ifndef GL_ARB_shadow
#define GL_TEXTURE_COMPARE_MODE_ARB       0x884C
#define GL_TEXTURE_COMPARE_FUNC_ARB       0x884D
#define GL_COMPARE_R_TO_TEXTURE_ARB       0x884E
#endif

#ifndef GL_ARB_shadow_ambient
#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF
#endif

#ifndef GL_ARB_window_pos
#endif

#ifndef GL_ARB_vertex_program
#define GL_COLOR_SUM_ARB                  0x8458
#define GL_VERTEX_PROGRAM_ARB             0x8620
#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622
#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB   0x8623
#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624
#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB   0x8625
#define GL_CURRENT_VERTEX_ATTRIB_ARB      0x8626
#define GL_PROGRAM_LENGTH_ARB             0x8627
#define GL_PROGRAM_STRING_ARB             0x8628
#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E
#define GL_MAX_PROGRAM_MATRICES_ARB       0x862F
#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640
#define GL_CURRENT_MATRIX_ARB             0x8641
#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB  0x8642
#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB    0x8643
#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645
#define GL_PROGRAM_ERROR_POSITION_ARB     0x864B
#define GL_PROGRAM_BINDING_ARB            0x8677
#define GL_MAX_VERTEX_ATTRIBS_ARB         0x8869
#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A
#define GL_PROGRAM_ERROR_STRING_ARB       0x8874
#define GL_PROGRAM_FORMAT_ASCII_ARB       0x8875
#define GL_PROGRAM_FORMAT_ARB             0x8876
#define GL_PROGRAM_INSTRUCTIONS_ARB       0x88A0
#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB   0x88A1
#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2
#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3
#define GL_PROGRAM_TEMPORARIES_ARB        0x88A4
#define GL_MAX_PROGRAM_TEMPORARIES_ARB    0x88A5
#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6
#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7
#define GL_PROGRAM_PARAMETERS_ARB         0x88A8
#define GL_MAX_PROGRAM_PARAMETERS_ARB     0x88A9
#define GL_PROGRAM_NATIVE_PARAMETERS_ARB  0x88AA
#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB
#define GL_PROGRAM_ATTRIBS_ARB            0x88AC
#define GL_MAX_PROGRAM_ATTRIBS_ARB        0x88AD
#define GL_PROGRAM_NATIVE_ATTRIBS_ARB     0x88AE
#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF
#define GL_PROGRAM_ADDRESS_REGISTERS_ARB  0x88B0
#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1
#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2
#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3
#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4
#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5
#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6
#define GL_TRANSPOSE_CURRENT_MATRIX_ARB   0x88B7
#define GL_MATRIX0_ARB                    0x88C0
#define GL_MATRIX1_ARB                    0x88C1
#define GL_MATRIX2_ARB                    0x88C2
#define GL_MATRIX3_ARB                    0x88C3
#define GL_MATRIX4_ARB                    0x88C4
#define GL_MATRIX5_ARB                    0x88C5
#define GL_MATRIX6_ARB                    0x88C6
#define GL_MATRIX7_ARB                    0x88C7
#define GL_MATRIX8_ARB                    0x88C8
#define GL_MATRIX9_ARB                    0x88C9
#define GL_MATRIX10_ARB                   0x88CA
#define GL_MATRIX11_ARB                   0x88CB
#define GL_MATRIX12_ARB                   0x88CC
#define GL_MATRIX13_ARB                   0x88CD
#define GL_MATRIX14_ARB                   0x88CE
#define GL_MATRIX15_ARB                   0x88CF
#define GL_MATRIX16_ARB                   0x88D0
#define GL_MATRIX17_ARB                   0x88D1
#define GL_MATRIX18_ARB                   0x88D2
#define GL_MATRIX19_ARB                   0x88D3
#define GL_MATRIX20_ARB                   0x88D4
#define GL_MATRIX21_ARB                   0x88D5
#define GL_MATRIX22_ARB                   0x88D6
#define GL_MATRIX23_ARB                   0x88D7
#define GL_MATRIX24_ARB                   0x88D8
#define GL_MATRIX25_ARB                   0x88D9
#define GL_MATRIX26_ARB                   0x88DA
#define GL_MATRIX27_ARB                   0x88DB
#define GL_MATRIX28_ARB                   0x88DC
#define GL_MATRIX29_ARB                   0x88DD
#define GL_MATRIX30_ARB                   0x88DE
#define GL_MATRIX31_ARB                   0x88DF
#endif

#ifndef GL_ARB_fragment_program
#define GL_FRAGMENT_PROGRAM_ARB           0x8804
#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB   0x8805
#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB   0x8806
#define GL_PROGRAM_TEX_INDIRECTIONS_ARB   0x8807
#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808
#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809
#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A
#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B
#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C
#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D
#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E
#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F
#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810
#define GL_MAX_TEXTURE_COORDS_ARB         0x8871
#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB    0x8872
#endif

#ifndef GL_ARB_vertex_buffer_object
#define GL_BUFFER_SIZE_ARB                0x8764
#define GL_BUFFER_USAGE_ARB               0x8765
#define GL_ARRAY_BUFFER_ARB               0x8892
#define GL_ELEMENT_ARRAY_BUFFER_ARB       0x8893
#define GL_ARRAY_BUFFER_BINDING_ARB       0x8894
#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895
#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896
#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897
#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898
#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899
#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A
#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B
#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C
#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D
#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E
#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F
#define GL_READ_ONLY_ARB                  0x88B8
#define GL_WRITE_ONLY_ARB                 0x88B9
#define GL_READ_WRITE_ARB                 0x88BA
#define GL_BUFFER_ACCESS_ARB              0x88BB
#define GL_BUFFER_MAPPED_ARB              0x88BC
#define GL_BUFFER_MAP_POINTER_ARB         0x88BD
#define GL_STREAM_DRAW_ARB                0x88E0
#define GL_STREAM_READ_ARB                0x88E1
#define GL_STREAM_COPY_ARB                0x88E2
#define GL_STATIC_DRAW_ARB                0x88E4
#define GL_STATIC_READ_ARB                0x88E5
#define GL_STATIC_COPY_ARB                0x88E6
#define GL_DYNAMIC_DRAW_ARB               0x88E8
#define GL_DYNAMIC_READ_ARB               0x88E9
#define GL_DYNAMIC_COPY_ARB               0x88EA
#endif

#ifndef GL_ARB_occlusion_query
#define GL_QUERY_COUNTER_BITS_ARB         0x8864
#define GL_CURRENT_QUERY_ARB              0x8865
#define GL_QUERY_RESULT_ARB               0x8866
#define GL_QUERY_RESULT_AVAILABLE_ARB     0x8867
#define GL_SAMPLES_PASSED_ARB             0x8914
#endif

#ifndef GL_ARB_shader_objects
#define GL_PROGRAM_OBJECT_ARB             0x8B40
#define GL_SHADER_OBJECT_ARB              0x8B48
#define GL_OBJECT_TYPE_ARB                0x8B4E
#define GL_OBJECT_SUBTYPE_ARB             0x8B4F
#define GL_FLOAT_VEC2_ARB                 0x8B50
#define GL_FLOAT_VEC3_ARB                 0x8B51
#define GL_FLOAT_VEC4_ARB                 0x8B52
#define GL_INT_VEC2_ARB                   0x8B53
#define GL_INT_VEC3_ARB                   0x8B54
#define GL_INT_VEC4_ARB                   0x8B55
#define GL_BOOL_ARB                       0x8B56
#define GL_BOOL_VEC2_ARB                  0x8B57
#define GL_BOOL_VEC3_ARB                  0x8B58
#define GL_BOOL_VEC4_ARB                  0x8B59
#define GL_FLOAT_MAT2_ARB                 0x8B5A
#define GL_FLOAT_MAT3_ARB                 0x8B5B
#define GL_FLOAT_MAT4_ARB                 0x8B5C
#define GL_SAMPLER_1D_ARB                 0x8B5D
#define GL_SAMPLER_2D_ARB                 0x8B5E
#define GL_SAMPLER_3D_ARB                 0x8B5F
#define GL_SAMPLER_CUBE_ARB               0x8B60
#define GL_SAMPLER_1D_SHADOW_ARB          0x8B61
#define GL_SAMPLER_2D_SHADOW_ARB          0x8B62
#define GL_SAMPLER_2D_RECT_ARB            0x8B63
#define GL_SAMPLER_2D_RECT_SHADOW_ARB     0x8B64
#define GL_OBJECT_DELETE_STATUS_ARB       0x8B80
#define GL_OBJECT_COMPILE_STATUS_ARB      0x8B81
#define GL_OBJECT_LINK_STATUS_ARB         0x8B82
#define GL_OBJECT_VALIDATE_STATUS_ARB     0x8B83
#define GL_OBJECT_INFO_LOG_LENGTH_ARB     0x8B84
#define GL_OBJECT_ATTACHED_OBJECTS_ARB    0x8B85
#define GL_OBJECT_ACTIVE_UNIFORMS_ARB     0x8B86
#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87
#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88
#endif

#ifndef GL_ARB_vertex_shader
#define GL_VERTEX_SHADER_ARB              0x8B31
#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A
#define GL_MAX_VARYING_FLOATS_ARB         0x8B4B
#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C
#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D
#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB   0x8B89
#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A
#endif

#ifndef GL_ARB_fragment_shader
#define GL_FRAGMENT_SHADER_ARB            0x8B30
#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49
#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B
#endif

#ifndef GL_ARB_shading_language_100
#define GL_SHADING_LANGUAGE_VERSION_ARB   0x8B8C
#endif

#ifndef GL_ARB_texture_non_power_of_two
#endif

#ifndef GL_ARB_point_sprite
#define GL_POINT_SPRITE_ARB               0x8861
#define GL_COORD_REPLACE_ARB              0x8862
#endif

#ifndef GL_ARB_fragment_program_shadow
#endif

#ifndef GL_ARB_draw_buffers
#define GL_MAX_DRAW_BUFFERS_ARB           0x8824
#define GL_DRAW_BUFFER0_ARB               0x8825
#define GL_DRAW_BUFFER1_ARB               0x8826
#define GL_DRAW_BUFFER2_ARB               0x8827
#define GL_DRAW_BUFFER3_ARB               0x8828
#define GL_DRAW_BUFFER4_ARB               0x8829
#define GL_DRAW_BUFFER5_ARB               0x882A
#define GL_DRAW_BUFFER6_ARB               0x882B
#define GL_DRAW_BUFFER7_ARB               0x882C
#define GL_DRAW_BUFFER8_ARB               0x882D
#define GL_DRAW_BUFFER9_ARB               0x882E
#define GL_DRAW_BUFFER10_ARB              0x882F
#define GL_DRAW_BUFFER11_ARB              0x8830
#define GL_DRAW_BUFFER12_ARB              0x8831
#define GL_DRAW_BUFFER13_ARB              0x8832
#define GL_DRAW_BUFFER14_ARB              0x8833
#define GL_DRAW_BUFFER15_ARB              0x8834
#endif

#ifndef GL_ARB_texture_rectangle
#define GL_TEXTURE_RECTANGLE_ARB          0x84F5
#define GL_TEXTURE_BINDING_RECTANGLE_ARB  0x84F6
#define GL_PROXY_TEXTURE_RECTANGLE_ARB    0x84F7
#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8
#endif

#ifndef GL_ARB_color_buffer_float
#define GL_RGBA_FLOAT_MODE_ARB            0x8820
#define GL_CLAMP_VERTEX_COLOR_ARB         0x891A
#define GL_CLAMP_FRAGMENT_COLOR_ARB       0x891B
#define GL_CLAMP_READ_COLOR_ARB           0x891C
#define GL_FIXED_ONLY_ARB                 0x891D
#endif

#ifndef GL_ARB_half_float_pixel
#define GL_HALF_FLOAT_ARB                 0x140B
#endif

#ifndef GL_ARB_texture_float
#define GL_TEXTURE_RED_TYPE_ARB           0x8C10
#define GL_TEXTURE_GREEN_TYPE_ARB         0x8C11
#define GL_TEXTURE_BLUE_TYPE_ARB          0x8C12
#define GL_TEXTURE_ALPHA_TYPE_ARB         0x8C13
#define GL_TEXTURE_LUMINANCE_TYPE_ARB     0x8C14
#define GL_TEXTURE_INTENSITY_TYPE_ARB     0x8C15
#define GL_TEXTURE_DEPTH_TYPE_ARB         0x8C16
#define GL_UNSIGNED_NORMALIZED_ARB        0x8C17
#define GL_RGBA32F_ARB                    0x8814
#define GL_RGB32F_ARB                     0x8815
#define GL_ALPHA32F_ARB                   0x8816
#define GL_INTENSITY32F_ARB               0x8817
#define GL_LUMINANCE32F_ARB               0x8818
#define GL_LUMINANCE_ALPHA32F_ARB         0x8819
#define GL_RGBA16F_ARB                    0x881A
#define GL_RGB16F_ARB                     0x881B
#define GL_ALPHA16F_ARB                   0x881C
#define GL_INTENSITY16F_ARB               0x881D
#define GL_LUMINANCE16F_ARB               0x881E
#define GL_LUMINANCE_ALPHA16F_ARB         0x881F
#endif

#ifndef GL_ARB_pixel_buffer_object
#define GL_PIXEL_PACK_BUFFER_ARB          0x88EB
#define GL_PIXEL_UNPACK_BUFFER_ARB        0x88EC
#define GL_PIXEL_PACK_BUFFER_BINDING_ARB  0x88ED
#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF
#endif

#ifndef GL_EXT_abgr
#define GL_ABGR_EXT                       0x8000
#endif

#ifndef GL_EXT_blend_color
#define GL_CONSTANT_COLOR_EXT             0x8001
#define GL_ONE_MINUS_CONSTANT_COLOR_EXT   0x8002
#define GL_CONSTANT_ALPHA_EXT             0x8003
#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT   0x8004
#define GL_BLEND_COLOR_EXT                0x8005
#endif

#ifndef GL_EXT_polygon_offset
#define GL_POLYGON_OFFSET_EXT             0x8037
#define GL_POLYGON_OFFSET_FACTOR_EXT      0x8038
#define GL_POLYGON_OFFSET_BIAS_EXT        0x8039
#endif

#ifndef GL_EXT_texture
#define GL_ALPHA4_EXT                     0x803B
#define GL_ALPHA8_EXT                     0x803C
#define GL_ALPHA12_EXT                    0x803D
#define GL_ALPHA16_EXT                    0x803E
#define GL_LUMINANCE4_EXT                 0x803F
#define GL_LUMINANCE8_EXT                 0x8040
#define GL_LUMINANCE12_EXT                0x8041
#define GL_LUMINANCE16_EXT                0x8042
#define GL_LUMINANCE4_ALPHA4_EXT          0x8043
#define GL_LUMINANCE6_ALPHA2_EXT          0x8044
#define GL_LUMINANCE8_ALPHA8_EXT          0x8045
#define GL_LUMINANCE12_ALPHA4_EXT         0x8046
#define GL_LUMINANCE12_ALPHA12_EXT        0x8047
#define GL_LUMINANCE16_ALPHA16_EXT        0x8048
#define GL_INTENSITY_EXT                  0x8049
#define GL_INTENSITY4_EXT                 0x804A
#define GL_INTENSITY8_EXT                 0x804B
#define GL_INTENSITY12_EXT                0x804C
#define GL_INTENSITY16_EXT                0x804D
#define GL_RGB2_EXT                       0x804E
#define GL_RGB4_EXT                       0x804F
#define GL_RGB5_EXT                       0x8050
#define GL_RGB8_EXT                       0x8051
#define GL_RGB10_EXT                      0x8052
#define GL_RGB12_EXT                      0x8053
#define GL_RGB16_EXT                      0x8054
#define GL_RGBA2_EXT                      0x8055
#define GL_RGBA4_EXT                      0x8056
#define GL_RGB5_A1_EXT                    0x8057
#define GL_RGBA8_EXT                      0x8058
#define GL_RGB10_A2_EXT                   0x8059
#define GL_RGBA12_EXT                     0x805A
#define GL_RGBA16_EXT                     0x805B
#define GL_TEXTURE_RED_SIZE_EXT           0x805C
#define GL_TEXTURE_GREEN_SIZE_EXT         0x805D
#define GL_TEXTURE_BLUE_SIZE_EXT          0x805E
#define GL_TEXTURE_ALPHA_SIZE_EXT         0x805F
#define GL_TEXTURE_LUMINANCE_SIZE_EXT     0x8060
#define GL_TEXTURE_INTENSITY_SIZE_EXT     0x8061
#define GL_REPLACE_EXT                    0x8062
#define GL_PROXY_TEXTURE_1D_EXT           0x8063
#define GL_PROXY_TEXTURE_2D_EXT           0x8064
#define GL_TEXTURE_TOO_LARGE_EXT          0x8065
#endif

#ifndef GL_EXT_texture3D
#define GL_PACK_SKIP_IMAGES_EXT           0x806B
#define GL_PACK_IMAGE_HEIGHT_EXT          0x806C
#define GL_UNPACK_SKIP_IMAGES_EXT         0x806D
#define GL_UNPACK_IMAGE_HEIGHT_EXT        0x806E
#define GL_TEXTURE_3D_EXT                 0x806F
#define GL_PROXY_TEXTURE_3D_EXT           0x8070
#define GL_TEXTURE_DEPTH_EXT              0x8071
#define GL_TEXTURE_WRAP_R_EXT             0x8072
#define GL_MAX_3D_TEXTURE_SIZE_EXT        0x8073
#endif

#ifndef GL_SGIS_texture_filter4
#define GL_FILTER4_SGIS                   0x8146
#define GL_TEXTURE_FILTER4_SIZE_SGIS      0x8147
#endif

#ifndef GL_EXT_subtexture
#endif

#ifndef GL_EXT_copy_texture
#endif

#ifndef GL_EXT_histogram
#define GL_HISTOGRAM_EXT                  0x8024
#define GL_PROXY_HISTOGRAM_EXT            0x8025
#define GL_HISTOGRAM_WIDTH_EXT            0x8026
#define GL_HISTOGRAM_FORMAT_EXT           0x8027
#define GL_HISTOGRAM_RED_SIZE_EXT         0x8028
#define GL_HISTOGRAM_GREEN_SIZE_EXT       0x8029
#define GL_HISTOGRAM_BLUE_SIZE_EXT        0x802A
#define GL_HISTOGRAM_ALPHA_SIZE_EXT       0x802B
#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT   0x802C
#define GL_HISTOGRAM_SINK_EXT             0x802D
#define GL_MINMAX_EXT                     0x802E
#define GL_MINMAX_FORMAT_EXT              0x802F
#define GL_MINMAX_SINK_EXT                0x8030
#define GL_TABLE_TOO_LARGE_EXT            0x8031
#endif

#ifndef GL_EXT_convolution
#define GL_CONVOLUTION_1D_EXT             0x8010
#define GL_CONVOLUTION_2D_EXT             0x8011
#define GL_SEPARABLE_2D_EXT               0x8012
#define GL_CONVOLUTION_BORDER_MODE_EXT    0x8013
#define GL_CONVOLUTION_FILTER_SCALE_EXT   0x8014
#define GL_CONVOLUTION_FILTER_BIAS_EXT    0x8015
#define GL_REDUCE_EXT                     0x8016
#define GL_CONVOLUTION_FORMAT_EXT         0x8017
#define GL_CONVOLUTION_WIDTH_EXT          0x8018
#define GL_CONVOLUTION_HEIGHT_EXT         0x8019
#define GL_MAX_CONVOLUTION_WIDTH_EXT      0x801A
#define GL_MAX_CONVOLUTION_HEIGHT_EXT     0x801B
#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C
#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D
#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E
#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F
#define GL_POST_CONVOLUTION_RED_BIAS_EXT  0x8020
#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021
#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022
#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023
#endif

#ifndef GL_SGI_color_matrix
#define GL_COLOR_MATRIX_SGI               0x80B1
#define GL_COLOR_MATRIX_STACK_DEPTH_SGI   0x80B2
#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3
#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4
#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5
#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6
#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7
#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8
#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9
#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA
#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB
#endif

#ifndef GL_SGI_color_table
#define GL_COLOR_TABLE_SGI                0x80D0
#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1
#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2
#define GL_PROXY_COLOR_TABLE_SGI          0x80D3
#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4
#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5
#define GL_COLOR_TABLE_SCALE_SGI          0x80D6
#define GL_COLOR_TABLE_BIAS_SGI           0x80D7
#define GL_COLOR_TABLE_FORMAT_SGI         0x80D8
#define GL_COLOR_TABLE_WIDTH_SGI          0x80D9
#define GL_COLOR_TABLE_RED_SIZE_SGI       0x80DA
#define GL_COLOR_TABLE_GREEN_SIZE_SGI     0x80DB
#define GL_COLOR_TABLE_BLUE_SIZE_SGI      0x80DC
#define GL_COLOR_TABLE_ALPHA_SIZE_SGI     0x80DD
#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE
#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF
#endif

#ifndef GL_SGIS_pixel_texture
#define GL_PIXEL_TEXTURE_SGIS             0x8353
#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354
#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355
#define GL_PIXEL_GROUP_COLOR_SGIS         0x8356
#endif

#ifndef GL_SGIX_pixel_texture
#define GL_PIXEL_TEX_GEN_SGIX             0x8139
#define GL_PIXEL_TEX_GEN_MODE_SGIX        0x832B
#endif

#ifndef GL_SGIS_texture4D
#define GL_PACK_SKIP_VOLUMES_SGIS         0x8130
#define GL_PACK_IMAGE_DEPTH_SGIS          0x8131
#define GL_UNPACK_SKIP_VOLUMES_SGIS       0x8132
#define GL_UNPACK_IMAGE_DEPTH_SGIS        0x8133
#define GL_TEXTURE_4D_SGIS                0x8134
#define GL_PROXY_TEXTURE_4D_SGIS          0x8135
#define GL_TEXTURE_4DSIZE_SGIS            0x8136
#define GL_TEXTURE_WRAP_Q_SGIS            0x8137
#define GL_MAX_4D_TEXTURE_SIZE_SGIS       0x8138
#define GL_TEXTURE_4D_BINDING_SGIS        0x814F
#endif

#ifndef GL_SGI_texture_color_table
#define GL_TEXTURE_COLOR_TABLE_SGI        0x80BC
#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI  0x80BD
#endif

#ifndef GL_EXT_cmyka
#define GL_CMYK_EXT                       0x800C
#define GL_CMYKA_EXT                      0x800D
#define GL_PACK_CMYK_HINT_EXT             0x800E
#define GL_UNPACK_CMYK_HINT_EXT           0x800F
#endif

#ifndef GL_EXT_texture_object
#define GL_TEXTURE_PRIORITY_EXT           0x8066
#define GL_TEXTURE_RESIDENT_EXT           0x8067
#define GL_TEXTURE_1D_BINDING_EXT         0x8068
#define GL_TEXTURE_2D_BINDING_EXT         0x8069
#define GL_TEXTURE_3D_BINDING_EXT         0x806A
#endif

#ifndef GL_SGIS_detail_texture
#define GL_DETAIL_TEXTURE_2D_SGIS         0x8095
#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096
#define GL_LINEAR_DETAIL_SGIS             0x8097
#define GL_LINEAR_DETAIL_ALPHA_SGIS       0x8098
#define GL_LINEAR_DETAIL_COLOR_SGIS       0x8099
#define GL_DETAIL_TEXTURE_LEVEL_SGIS      0x809A
#define GL_DETAIL_TEXTURE_MODE_SGIS       0x809B
#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C
#endif

#ifndef GL_SGIS_sharpen_texture
#define GL_LINEAR_SHARPEN_SGIS            0x80AD
#define GL_LINEAR_SHARPEN_ALPHA_SGIS      0x80AE
#define GL_LINEAR_SHARPEN_COLOR_SGIS      0x80AF
#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0
#endif

#ifndef GL_EXT_packed_pixels
#define GL_UNSIGNED_BYTE_3_3_2_EXT        0x8032
#define GL_UNSIGNED_SHORT_4_4_4_4_EXT     0x8033
#define GL_UNSIGNED_SHORT_5_5_5_1_EXT     0x8034
#define GL_UNSIGNED_INT_8_8_8_8_EXT       0x8035
#define GL_UNSIGNED_INT_10_10_10_2_EXT    0x8036
#endif

#ifndef GL_SGIS_texture_lod
#define GL_TEXTURE_MIN_LOD_SGIS           0x813A
#define GL_TEXTURE_MAX_LOD_SGIS           0x813B
#define GL_TEXTURE_BASE_LEVEL_SGIS        0x813C
#define GL_TEXTURE_MAX_LEVEL_SGIS         0x813D
#endif

#ifndef GL_SGIS_multisample
#define GL_MULTISAMPLE_SGIS               0x809D
#define GL_SAMPLE_ALPHA_TO_MASK_SGIS      0x809E
#define GL_SAMPLE_ALPHA_TO_ONE_SGIS       0x809F
#define GL_SAMPLE_MASK_SGIS               0x80A0
#define GL_1PASS_SGIS                     0x80A1
#define GL_2PASS_0_SGIS                   0x80A2
#define GL_2PASS_1_SGIS                   0x80A3
#define GL_4PASS_0_SGIS                   0x80A4
#define GL_4PASS_1_SGIS                   0x80A5
#define GL_4PASS_2_SGIS                   0x80A6
#define GL_4PASS_3_SGIS                   0x80A7
#define GL_SAMPLE_BUFFERS_SGIS            0x80A8
#define GL_SAMPLES_SGIS                   0x80A9
#define GL_SAMPLE_MASK_VALUE_SGIS         0x80AA
#define GL_SAMPLE_MASK_INVERT_SGIS        0x80AB
#define GL_SAMPLE_PATTERN_SGIS            0x80AC
#endif

#ifndef GL_EXT_rescale_normal
#define GL_RESCALE_NORMAL_EXT             0x803A
#endif

#ifndef GL_EXT_vertex_array
#define GL_VERTEX_ARRAY_EXT               0x8074
#define GL_NORMAL_ARRAY_EXT               0x8075
#define GL_COLOR_ARRAY_EXT                0x8076
#define GL_INDEX_ARRAY_EXT                0x8077
#define GL_TEXTURE_COORD_ARRAY_EXT        0x8078
#define GL_EDGE_FLAG_ARRAY_EXT            0x8079
#define GL_VERTEX_ARRAY_SIZE_EXT          0x807A
#define GL_VERTEX_ARRAY_TYPE_EXT          0x807B
#define GL_VERTEX_ARRAY_STRIDE_EXT        0x807C
#define GL_VERTEX_ARRAY_COUNT_EXT         0x807D
#define GL_NORMAL_ARRAY_TYPE_EXT          0x807E
#define GL_NORMAL_ARRAY_STRIDE_EXT        0x807F
#define GL_NORMAL_ARRAY_COUNT_EXT         0x8080
#define GL_COLOR_ARRAY_SIZE_EXT           0x8081
#define GL_COLOR_ARRAY_TYPE_EXT           0x8082
#define GL_COLOR_ARRAY_STRIDE_EXT         0x8083
#define GL_COLOR_ARRAY_COUNT_EXT          0x8084
#define GL_INDEX_ARRAY_TYPE_EXT           0x8085
#define GL_INDEX_ARRAY_STRIDE_EXT         0x8086
#define GL_INDEX_ARRAY_COUNT_EXT          0x8087
#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT   0x8088
#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT   0x8089
#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A
#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT  0x808B
#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT     0x808C
#define GL_EDGE_FLAG_ARRAY_COUNT_EXT      0x808D
#define GL_VERTEX_ARRAY_POINTER_EXT       0x808E
#define GL_NORMAL_ARRAY_POINTER_EXT       0x808F
#define GL_COLOR_ARRAY_POINTER_EXT        0x8090
#define GL_INDEX_ARRAY_POINTER_EXT        0x8091
#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092
#define GL_EDGE_FLAG_ARRAY_POINTER_EXT    0x8093
#endif

#ifndef GL_EXT_misc_attribute
#endif

#ifndef GL_SGIS_generate_mipmap
#define GL_GENERATE_MIPMAP_SGIS           0x8191
#define GL_GENERATE_MIPMAP_HINT_SGIS      0x8192
#endif

#ifndef GL_SGIX_clipmap
#define GL_LINEAR_CLIPMAP_LINEAR_SGIX     0x8170
#define GL_TEXTURE_CLIPMAP_CENTER_SGIX    0x8171
#define GL_TEXTURE_CLIPMAP_FRAME_SGIX     0x8172
#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX    0x8173
#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174
#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175
#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX     0x8176
#define GL_MAX_CLIPMAP_DEPTH_SGIX         0x8177
#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178
#define GL_NEAREST_CLIPMAP_NEAREST_SGIX   0x844D
#define GL_NEAREST_CLIPMAP_LINEAR_SGIX    0x844E
#define GL_LINEAR_CLIPMAP_NEAREST_SGIX    0x844F
#endif

#ifndef GL_SGIX_shadow
#define GL_TEXTURE_COMPARE_SGIX           0x819A
#define GL_TEXTURE_COMPARE_OPERATOR_SGIX  0x819B
#define GL_TEXTURE_LEQUAL_R_SGIX          0x819C
#define GL_TEXTURE_GEQUAL_R_SGIX          0x819D
#endif

#ifndef GL_SGIS_texture_edge_clamp
#define GL_CLAMP_TO_EDGE_SGIS             0x812F
#endif

#ifndef GL_SGIS_texture_border_clamp
#define GL_CLAMP_TO_BORDER_SGIS           0x812D
#endif

#ifndef GL_EXT_blend_minmax
#define GL_FUNC_ADD_EXT                   0x8006
#define GL_MIN_EXT                        0x8007
#define GL_MAX_EXT                        0x8008
#define GL_BLEND_EQUATION_EXT             0x8009
#endif

#ifndef GL_EXT_blend_subtract
#define GL_FUNC_SUBTRACT_EXT              0x800A
#define GL_FUNC_REVERSE_SUBTRACT_EXT      0x800B
#endif

#ifndef GL_EXT_blend_logic_op
#endif

#ifndef GL_SGIX_interlace
#define GL_INTERLACE_SGIX                 0x8094
#endif

#ifndef GL_SGIX_pixel_tiles
#define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E
#define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F
#define GL_PIXEL_TILE_WIDTH_SGIX          0x8140
#define GL_PIXEL_TILE_HEIGHT_SGIX         0x8141
#define GL_PIXEL_TILE_GRID_WIDTH_SGIX     0x8142
#define GL_PIXEL_TILE_GRID_HEIGHT_SGIX    0x8143
#define GL_PIXEL_TILE_GRID_DEPTH_SGIX     0x8144
#define GL_PIXEL_TILE_CACHE_SIZE_SGIX     0x8145
#endif

#ifndef GL_SGIS_texture_select
#define GL_DUAL_ALPHA4_SGIS               0x8110
#define GL_DUAL_ALPHA8_SGIS               0x8111
#define GL_DUAL_ALPHA12_SGIS              0x8112
#define GL_DUAL_ALPHA16_SGIS              0x8113
#define GL_DUAL_LUMINANCE4_SGIS           0x8114
#define GL_DUAL_LUMINANCE8_SGIS           0x8115
#define GL_DUAL_LUMINANCE12_SGIS          0x8116
#define GL_DUAL_LUMINANCE16_SGIS          0x8117
#define GL_DUAL_INTENSITY4_SGIS           0x8118
#define GL_DUAL_INTENSITY8_SGIS           0x8119
#define GL_DUAL_INTENSITY12_SGIS          0x811A
#define GL_DUAL_INTENSITY16_SGIS          0x811B
#define GL_DUAL_LUMINANCE_ALPHA4_SGIS     0x811C
#define GL_DUAL_LUMINANCE_ALPHA8_SGIS     0x811D
#define GL_QUAD_ALPHA4_SGIS               0x811E
#define GL_QUAD_ALPHA8_SGIS               0x811F
#define GL_QUAD_LUMINANCE4_SGIS           0x8120
#define GL_QUAD_LUMINANCE8_SGIS           0x8121
#define GL_QUAD_INTENSITY4_SGIS           0x8122
#define GL_QUAD_INTENSITY8_SGIS           0x8123
#define GL_DUAL_TEXTURE_SELECT_SGIS       0x8124
#define GL_QUAD_TEXTURE_SELECT_SGIS       0x8125
#endif

#ifndef GL_SGIX_sprite
#define GL_SPRITE_SGIX                    0x8148
#define GL_SPRITE_MODE_SGIX               0x8149
#define GL_SPRITE_AXIS_SGIX               0x814A
#define GL_SPRITE_TRANSLATION_SGIX        0x814B
#define GL_SPRITE_AXIAL_SGIX              0x814C
#define GL_SPRITE_OBJECT_ALIGNED_SGIX     0x814D
#define GL_SPRITE_EYE_ALIGNED_SGIX        0x814E
#endif

#ifndef GL_SGIX_texture_multi_buffer
#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E
#endif

#ifndef GL_EXT_point_parameters
#define GL_POINT_SIZE_MIN_EXT             0x8126
#define GL_POINT_SIZE_MAX_EXT             0x8127
#define GL_POINT_FADE_THRESHOLD_SIZE_EXT  0x8128
#define GL_DISTANCE_ATTENUATION_EXT       0x8129
#endif

#ifndef GL_SGIS_point_parameters
#define GL_POINT_SIZE_MIN_SGIS            0x8126
#define GL_POINT_SIZE_MAX_SGIS            0x8127
#define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128
#define GL_DISTANCE_ATTENUATION_SGIS      0x8129
#endif

#ifndef GL_SGIX_instruments
#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180
#define GL_INSTRUMENT_MEASUREMENTS_SGIX   0x8181
#endif

#ifndef GL_SGIX_texture_scale_bias
#define GL_POST_TEXTURE_FILTER_BIAS_SGIX  0x8179
#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A
#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B
#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C
#endif

#ifndef GL_SGIX_framezoom
#define GL_FRAMEZOOM_SGIX                 0x818B
#define GL_FRAMEZOOM_FACTOR_SGIX          0x818C
#define GL_MAX_FRAMEZOOM_FACTOR_SGIX      0x818D
#endif

#ifndef GL_SGIX_tag_sample_buffer
#endif

#ifndef GL_FfdMaskSGIX
#define GL_TEXTURE_DEFORMATION_BIT_SGIX   0x00000001
#define GL_GEOMETRY_DEFORMATION_BIT_SGIX  0x00000002
#endif

#ifndef GL_SGIX_polynomial_ffd
#define GL_GEOMETRY_DEFORMATION_SGIX      0x8194
#define GL_TEXTURE_DEFORMATION_SGIX       0x8195
#define GL_DEFORMATIONS_MASK_SGIX         0x8196
#define GL_MAX_DEFORMATION_ORDER_SGIX     0x8197
#endif

#ifndef GL_SGIX_reference_plane
#define GL_REFERENCE_PLANE_SGIX           0x817D
#define GL_REFERENCE_PLANE_EQUATION_SGIX  0x817E
#endif

#ifndef GL_SGIX_flush_raster
#endif

#ifndef GL_SGIX_depth_texture
#define GL_DEPTH_COMPONENT16_SGIX         0x81A5
#define GL_DEPTH_COMPONENT24_SGIX         0x81A6
#define GL_DEPTH_COMPONENT32_SGIX         0x81A7
#endif

#ifndef GL_SGIS_fog_function
#define GL_FOG_FUNC_SGIS                  0x812A
#define GL_FOG_FUNC_POINTS_SGIS           0x812B
#define GL_MAX_FOG_FUNC_POINTS_SGIS       0x812C
#endif

#ifndef GL_SGIX_fog_offset
#define GL_FOG_OFFSET_SGIX                0x8198
#define GL_FOG_OFFSET_VALUE_SGIX          0x8199
#endif

#ifndef GL_HP_image_transform
#define GL_IMAGE_SCALE_X_HP               0x8155
#define GL_IMAGE_SCALE_Y_HP               0x8156
#define GL_IMAGE_TRANSLATE_X_HP           0x8157
#define GL_IMAGE_TRANSLATE_Y_HP           0x8158
#define GL_IMAGE_ROTATE_ANGLE_HP          0x8159
#define GL_IMAGE_ROTATE_ORIGIN_X_HP       0x815A
#define GL_IMAGE_ROTATE_ORIGIN_Y_HP       0x815B
#define GL_IMAGE_MAG_FILTER_HP            0x815C
#define GL_IMAGE_MIN_FILTER_HP            0x815D
#define GL_IMAGE_CUBIC_WEIGHT_HP          0x815E
#define GL_CUBIC_HP                       0x815F
#define GL_AVERAGE_HP                     0x8160
#define GL_IMAGE_TRANSFORM_2D_HP          0x8161
#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162
#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163
#endif

#ifndef GL_HP_convolution_border_modes
#define GL_IGNORE_BORDER_HP               0x8150
#define GL_CONSTANT_BORDER_HP             0x8151
#define GL_REPLICATE_BORDER_HP            0x8153
#define GL_CONVOLUTION_BORDER_COLOR_HP    0x8154
#endif

#ifndef GL_INGR_palette_buffer
#endif

#ifndef GL_SGIX_texture_add_env
#define GL_TEXTURE_ENV_BIAS_SGIX          0x80BE
#endif

#ifndef GL_EXT_color_subtable
#endif

#ifndef GL_PGI_vertex_hints
#define GL_VERTEX_DATA_HINT_PGI           0x1A22A
#define GL_VERTEX_CONSISTENT_HINT_PGI     0x1A22B
#define GL_MATERIAL_SIDE_HINT_PGI         0x1A22C
#define GL_MAX_VERTEX_HINT_PGI            0x1A22D
#define GL_COLOR3_BIT_PGI                 0x00010000
#define GL_COLOR4_BIT_PGI                 0x00020000
#define GL_EDGEFLAG_BIT_PGI               0x00040000
#define GL_INDEX_BIT_PGI                  0x00080000
#define GL_MAT_AMBIENT_BIT_PGI            0x00100000
#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000
#define GL_MAT_DIFFUSE_BIT_PGI            0x00400000
#define GL_MAT_EMISSION_BIT_PGI           0x00800000
#define GL_MAT_COLOR_INDEXES_BIT_PGI      0x01000000
#define GL_MAT_SHININESS_BIT_PGI          0x02000000
#define GL_MAT_SPECULAR_BIT_PGI           0x04000000
#define GL_NORMAL_BIT_PGI                 0x08000000
#define GL_TEXCOORD1_BIT_PGI              0x10000000
#define GL_TEXCOORD2_BIT_PGI              0x20000000
#define GL_TEXCOORD3_BIT_PGI              0x40000000
#define GL_TEXCOORD4_BIT_PGI              0x80000000
#define GL_VERTEX23_BIT_PGI               0x00000004
#define GL_VERTEX4_BIT_PGI                0x00000008
#endif

#ifndef GL_PGI_misc_hints
#define GL_PREFER_DOUBLEBUFFER_HINT_PGI   0x1A1F8
#define GL_CONSERVE_MEMORY_HINT_PGI       0x1A1FD
#define GL_RECLAIM_MEMORY_HINT_PGI        0x1A1FE
#define GL_NATIVE_GRAPHICS_HANDLE_PGI     0x1A202
#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203
#define GL_NATIVE_GRAPHICS_END_HINT_PGI   0x1A204
#define GL_ALWAYS_FAST_HINT_PGI           0x1A20C
#define GL_ALWAYS_SOFT_HINT_PGI           0x1A20D
#define GL_ALLOW_DRAW_OBJ_HINT_PGI        0x1A20E
#define GL_ALLOW_DRAW_WIN_HINT_PGI        0x1A20F
#define GL_ALLOW_DRAW_FRG_HINT_PGI        0x1A210
#define GL_ALLOW_DRAW_MEM_HINT_PGI        0x1A211
#define GL_STRICT_DEPTHFUNC_HINT_PGI      0x1A216
#define GL_STRICT_LIGHTING_HINT_PGI       0x1A217
#define GL_STRICT_SCISSOR_HINT_PGI        0x1A218
#define GL_FULL_STIPPLE_HINT_PGI          0x1A219
#define GL_CLIP_NEAR_HINT_PGI             0x1A220
#define GL_CLIP_FAR_HINT_PGI              0x1A221
#define GL_WIDE_LINE_HINT_PGI             0x1A222
#define GL_BACK_NORMALS_HINT_PGI          0x1A223
#endif

#ifndef GL_EXT_paletted_texture
#define GL_COLOR_INDEX1_EXT               0x80E2
#define GL_COLOR_INDEX2_EXT               0x80E3
#define GL_COLOR_INDEX4_EXT               0x80E4
#define GL_COLOR_INDEX8_EXT               0x80E5
#define GL_COLOR_INDEX12_EXT              0x80E6
#define GL_COLOR_INDEX16_EXT              0x80E7
#define GL_TEXTURE_INDEX_SIZE_EXT         0x80ED
#endif

#ifndef GL_EXT_clip_volume_hint
#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT  0x80F0
#endif

#ifndef GL_SGIX_list_priority
#define GL_LIST_PRIORITY_SGIX             0x8182
#endif

#ifndef GL_SGIX_ir_instrument1
#define GL_IR_INSTRUMENT1_SGIX            0x817F
#endif

#ifndef GL_SGIX_calligraphic_fragment
#define GL_CALLIGRAPHIC_FRAGMENT_SGIX     0x8183
#endif

#ifndef GL_SGIX_texture_lod_bias
#define GL_TEXTURE_LOD_BIAS_S_SGIX        0x818E
#define GL_TEXTURE_LOD_BIAS_T_SGIX        0x818F
#define GL_TEXTURE_LOD_BIAS_R_SGIX        0x8190
#endif

#ifndef GL_SGIX_shadow_ambient
#define GL_SHADOW_AMBIENT_SGIX            0x80BF
#endif

#ifndef GL_EXT_index_texture
#endif

#ifndef GL_EXT_index_material
#define GL_INDEX_MATERIAL_EXT             0x81B8
#define GL_INDEX_MATERIAL_PARAMETER_EXT   0x81B9
#define GL_INDEX_MATERIAL_FACE_EXT        0x81BA
#endif

#ifndef GL_EXT_index_func
#define GL_INDEX_TEST_EXT                 0x81B5
#define GL_INDEX_TEST_FUNC_EXT            0x81B6
#define GL_INDEX_TEST_REF_EXT             0x81B7
#endif

#ifndef GL_EXT_index_array_formats
#define GL_IUI_V2F_EXT                    0x81AD
#define GL_IUI_V3F_EXT                    0x81AE
#define GL_IUI_N3F_V2F_EXT                0x81AF
#define GL_IUI_N3F_V3F_EXT                0x81B0
#define GL_T2F_IUI_V2F_EXT                0x81B1
#define GL_T2F_IUI_V3F_EXT                0x81B2
#define GL_T2F_IUI_N3F_V2F_EXT            0x81B3
#define GL_T2F_IUI_N3F_V3F_EXT            0x81B4
#endif

#ifndef GL_EXT_compiled_vertex_array
#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT   0x81A8
#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT   0x81A9
#endif

#ifndef GL_EXT_cull_vertex
#define GL_CULL_VERTEX_EXT                0x81AA
#define GL_CULL_VERTEX_EYE_POSITION_EXT   0x81AB
#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC
#endif

#ifndef GL_SGIX_ycrcb
#define GL_YCRCB_422_SGIX                 0x81BB
#define GL_YCRCB_444_SGIX                 0x81BC
#endif

#ifndef GL_SGIX_fragment_lighting
#define GL_FRAGMENT_LIGHTING_SGIX         0x8400
#define GL_FRAGMENT_COLOR_MATERIAL_SGIX   0x8401
#define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402
#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403
#define GL_MAX_FRAGMENT_LIGHTS_SGIX       0x8404
#define GL_MAX_ACTIVE_LIGHTS_SGIX         0x8405
#define GL_CURRENT_RASTER_NORMAL_SGIX     0x8406
#define GL_LIGHT_ENV_MODE_SGIX            0x8407
#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408
#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409
#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A
#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B
#define GL_FRAGMENT_LIGHT0_SGIX           0x840C
#define GL_FRAGMENT_LIGHT1_SGIX           0x840D
#define GL_FRAGMENT_LIGHT2_SGIX           0x840E
#define GL_FRAGMENT_LIGHT3_SGIX           0x840F
#define GL_FRAGMENT_LIGHT4_SGIX           0x8410
#define GL_FRAGMENT_LIGHT5_SGIX           0x8411
#define GL_FRAGMENT_LIGHT6_SGIX           0x8412
#define GL_FRAGMENT_LIGHT7_SGIX           0x8413
#endif

#ifndef GL_IBM_rasterpos_clip
#define GL_RASTER_POSITION_UNCLIPPED_IBM  0x19262
#endif

#ifndef GL_HP_texture_lighting
#define GL_TEXTURE_LIGHTING_MODE_HP       0x8167
#define GL_TEXTURE_POST_SPECULAR_HP       0x8168
#define GL_TEXTURE_PRE_SPECULAR_HP        0x8169
#endif

#ifndef GL_EXT_draw_range_elements
#define GL_MAX_ELEMENTS_VERTICES_EXT      0x80E8
#define GL_MAX_ELEMENTS_INDICES_EXT       0x80E9
#endif

#ifndef GL_WIN_phong_shading
#define GL_PHONG_WIN                      0x80EA
#define GL_PHONG_HINT_WIN                 0x80EB
#endif

#ifndef GL_WIN_specular_fog
#define GL_FOG_SPECULAR_TEXTURE_WIN       0x80EC
#endif

#ifndef GL_EXT_light_texture
#define GL_FRAGMENT_MATERIAL_EXT          0x8349
#define GL_FRAGMENT_NORMAL_EXT            0x834A
#define GL_FRAGMENT_COLOR_EXT             0x834C
#define GL_ATTENUATION_EXT                0x834D
#define GL_SHADOW_ATTENUATION_EXT         0x834E
#define GL_TEXTURE_APPLICATION_MODE_EXT   0x834F
#define GL_TEXTURE_LIGHT_EXT              0x8350
#define GL_TEXTURE_MATERIAL_FACE_EXT      0x8351
#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352
/* reuse GL_FRAGMENT_DEPTH_EXT */
#endif

#ifndef GL_SGIX_blend_alpha_minmax
#define GL_ALPHA_MIN_SGIX                 0x8320
#define GL_ALPHA_MAX_SGIX                 0x8321
#endif

#ifndef GL_SGIX_impact_pixel_texture
#define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX   0x8184
#define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX     0x8185
#define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX     0x8186
#define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187
#define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188
#define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX    0x8189
#define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX    0x818A
#endif

#ifndef GL_EXT_bgra
#define GL_BGR_EXT                        0x80E0
#define GL_BGRA_EXT                       0x80E1
#endif

#ifndef GL_SGIX_async
#define GL_ASYNC_MARKER_SGIX              0x8329
#endif

#ifndef GL_SGIX_async_pixel
#define GL_ASYNC_TEX_IMAGE_SGIX           0x835C
#define GL_ASYNC_DRAW_PIXELS_SGIX         0x835D
#define GL_ASYNC_READ_PIXELS_SGIX         0x835E
#define GL_MAX_ASYNC_TEX_IMAGE_SGIX       0x835F
#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX     0x8360
#define GL_MAX_ASYNC_READ_PIXELS_SGIX     0x8361
#endif

#ifndef GL_SGIX_async_histogram
#define GL_ASYNC_HISTOGRAM_SGIX           0x832C
#define GL_MAX_ASYNC_HISTOGRAM_SGIX       0x832D
#endif

#ifndef GL_INTEL_texture_scissor
#endif

#ifndef GL_INTEL_parallel_arrays
#define GL_PARALLEL_ARRAYS_INTEL          0x83F4
#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5
#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6
#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7
#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8
#endif

#ifndef GL_HP_occlusion_test
#define GL_OCCLUSION_TEST_HP              0x8165
#define GL_OCCLUSION_TEST_RESULT_HP       0x8166
#endif

#ifndef GL_EXT_pixel_transform
#define GL_PIXEL_TRANSFORM_2D_EXT         0x8330
#define GL_PIXEL_MAG_FILTER_EXT           0x8331
#define GL_PIXEL_MIN_FILTER_EXT           0x8332
#define GL_PIXEL_CUBIC_WEIGHT_EXT         0x8333
#define GL_CUBIC_EXT                      0x8334
#define GL_AVERAGE_EXT                    0x8335
#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336
#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337
#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT  0x8338
#endif

#ifndef GL_EXT_pixel_transform_color_table
#endif

#ifndef GL_EXT_shared_texture_palette
#define GL_SHARED_TEXTURE_PALETTE_EXT     0x81FB
#endif

#ifndef GL_EXT_separate_specular_color
#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT  0x81F8
#define GL_SINGLE_COLOR_EXT               0x81F9
#define GL_SEPARATE_SPECULAR_COLOR_EXT    0x81FA
#endif

#ifndef GL_EXT_secondary_color
#define GL_COLOR_SUM_EXT                  0x8458
#define GL_CURRENT_SECONDARY_COLOR_EXT    0x8459
#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A
#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B
#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C
#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D
#define GL_SECONDARY_COLOR_ARRAY_EXT      0x845E
#endif

#ifndef GL_EXT_texture_perturb_normal
#define GL_PERTURB_EXT                    0x85AE
#define GL_TEXTURE_NORMAL_EXT             0x85AF
#endif

#ifndef GL_EXT_multi_draw_arrays
#endif

#ifndef GL_EXT_fog_coord
#define GL_FOG_COORDINATE_SOURCE_EXT      0x8450
#define GL_FOG_COORDINATE_EXT             0x8451
#define GL_FRAGMENT_DEPTH_EXT             0x8452
#define GL_CURRENT_FOG_COORDINATE_EXT     0x8453
#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT  0x8454
#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455
#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456
#define GL_FOG_COORDINATE_ARRAY_EXT       0x8457
#endif

#ifndef GL_REND_screen_coordinates
#define GL_SCREEN_COORDINATES_REND        0x8490
#define GL_INVERTED_SCREEN_W_REND         0x8491
#endif

#ifndef GL_EXT_coordinate_frame
#define GL_TANGENT_ARRAY_EXT              0x8439
#define GL_BINORMAL_ARRAY_EXT             0x843A
#define GL_CURRENT_TANGENT_EXT            0x843B
#define GL_CURRENT_BINORMAL_EXT           0x843C
#define GL_TANGENT_ARRAY_TYPE_EXT         0x843E
#define GL_TANGENT_ARRAY_STRIDE_EXT       0x843F
#define GL_BINORMAL_ARRAY_TYPE_EXT        0x8440
#define GL_BINORMAL_ARRAY_STRIDE_EXT      0x8441
#define GL_TANGENT_ARRAY_POINTER_EXT      0x8442
#define GL_BINORMAL_ARRAY_POINTER_EXT     0x8443
#define GL_MAP1_TANGENT_EXT               0x8444
#define GL_MAP2_TANGENT_EXT               0x8445
#define GL_MAP1_BINORMAL_EXT              0x8446
#define GL_MAP2_BINORMAL_EXT              0x8447
#endif

#ifndef GL_EXT_texture_env_combine
#define GL_COMBINE_EXT                    0x8570
#define GL_COMBINE_RGB_EXT                0x8571
#define GL_COMBINE_ALPHA_EXT              0x8572
#define GL_RGB_SCALE_EXT                  0x8573
#define GL_ADD_SIGNED_EXT                 0x8574
#define GL_INTERPOLATE_EXT                0x8575
#define GL_CONSTANT_EXT                   0x8576
#define GL_PRIMARY_COLOR_EXT              0x8577
#define GL_PREVIOUS_EXT                   0x8578
#define GL_SOURCE0_RGB_EXT                0x8580
#define GL_SOURCE1_RGB_EXT                0x8581
#define GL_SOURCE2_RGB_EXT                0x8582
#define GL_SOURCE0_ALPHA_EXT              0x8588
#define GL_SOURCE1_ALPHA_EXT              0x8589
#define GL_SOURCE2_ALPHA_EXT              0x858A
#define GL_OPERAND0_RGB_EXT               0x8590
#define GL_OPERAND1_RGB_EXT               0x8591
#define GL_OPERAND2_RGB_EXT               0x8592
#define GL_OPERAND0_ALPHA_EXT             0x8598
#define GL_OPERAND1_ALPHA_EXT             0x8599
#define GL_OPERAND2_ALPHA_EXT             0x859A
#endif

#ifndef GL_APPLE_specular_vector
#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0
#endif

#ifndef GL_APPLE_transform_hint
#define GL_TRANSFORM_HINT_APPLE           0x85B1
#endif

#ifndef GL_SGIX_fog_scale
#define GL_FOG_SCALE_SGIX                 0x81FC
#define GL_FOG_SCALE_VALUE_SGIX           0x81FD
#endif

#ifndef GL_SUNX_constant_data
#define GL_UNPACK_CONSTANT_DATA_SUNX      0x81D5
#define GL_TEXTURE_CONSTANT_DATA_SUNX     0x81D6
#endif

#ifndef GL_SUN_global_alpha
#define GL_GLOBAL_ALPHA_SUN               0x81D9
#define GL_GLOBAL_ALPHA_FACTOR_SUN        0x81DA
#endif

#ifndef GL_SUN_triangle_list
#define GL_RESTART_SUN                    0x0001
#define GL_REPLACE_MIDDLE_SUN             0x0002
#define GL_REPLACE_OLDEST_SUN             0x0003
#define GL_TRIANGLE_LIST_SUN              0x81D7
#define GL_REPLACEMENT_CODE_SUN           0x81D8
#define GL_REPLACEMENT_CODE_ARRAY_SUN     0x85C0
#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1
#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2
#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3
#define GL_R1UI_V3F_SUN                   0x85C4
#define GL_R1UI_C4UB_V3F_SUN              0x85C5
#define GL_R1UI_C3F_V3F_SUN               0x85C6
#define GL_R1UI_N3F_V3F_SUN               0x85C7
#define GL_R1UI_C4F_N3F_V3F_SUN           0x85C8
#define GL_R1UI_T2F_V3F_SUN               0x85C9
#define GL_R1UI_T2F_N3F_V3F_SUN           0x85CA
#define GL_R1UI_T2F_C4F_N3F_V3F_SUN       0x85CB
#endif

#ifndef GL_SUN_vertex
#endif

#ifndef GL_EXT_blend_func_separate
#define GL_BLEND_DST_RGB_EXT              0x80C8
#define GL_BLEND_SRC_RGB_EXT              0x80C9
#define GL_BLEND_DST_ALPHA_EXT            0x80CA
#define GL_BLEND_SRC_ALPHA_EXT            0x80CB
#endif

#ifndef GL_INGR_color_clamp
#define GL_RED_MIN_CLAMP_INGR             0x8560
#define GL_GREEN_MIN_CLAMP_INGR           0x8561
#define GL_BLUE_MIN_CLAMP_INGR            0x8562
#define GL_ALPHA_MIN_CLAMP_INGR           0x8563
#define GL_RED_MAX_CLAMP_INGR             0x8564
#define GL_GREEN_MAX_CLAMP_INGR           0x8565
#define GL_BLUE_MAX_CLAMP_INGR            0x8566
#define GL_ALPHA_MAX_CLAMP_INGR           0x8567
#endif

#ifndef GL_INGR_interlace_read
#define GL_INTERLACE_READ_INGR            0x8568
#endif

#ifndef GL_EXT_stencil_wrap
#define GL_INCR_WRAP_EXT                  0x8507
#define GL_DECR_WRAP_EXT                  0x8508
#endif

#ifndef GL_EXT_422_pixels
#define GL_422_EXT                        0x80CC
#define GL_422_REV_EXT                    0x80CD
#define GL_422_AVERAGE_EXT                0x80CE
#define GL_422_REV_AVERAGE_EXT            0x80CF
#endif

#ifndef GL_NV_texgen_reflection
#define GL_NORMAL_MAP_NV                  0x8511
#define GL_REFLECTION_MAP_NV              0x8512
#endif

#ifndef GL_EXT_texture_cube_map
#define GL_NORMAL_MAP_EXT                 0x8511
#define GL_REFLECTION_MAP_EXT             0x8512
#define GL_TEXTURE_CUBE_MAP_EXT           0x8513
#define GL_TEXTURE_BINDING_CUBE_MAP_EXT   0x8514
#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516
#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518
#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519
#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A
#define GL_PROXY_TEXTURE_CUBE_MAP_EXT     0x851B
#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT  0x851C
#endif

#ifndef GL_SUN_convolution_border_modes
#define GL_WRAP_BORDER_SUN                0x81D4
#endif

#ifndef GL_EXT_texture_env_add
#endif

#ifndef GL_EXT_texture_lod_bias
#define GL_MAX_TEXTURE_LOD_BIAS_EXT       0x84FD
#define GL_TEXTURE_FILTER_CONTROL_EXT     0x8500
#define GL_TEXTURE_LOD_BIAS_EXT           0x8501
#endif

#ifndef GL_EXT_texture_filter_anisotropic
#define GL_TEXTURE_MAX_ANISOTROPY_EXT     0x84FE
#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF
#endif

#ifndef GL_EXT_vertex_weighting
#define GL_MODELVIEW0_STACK_DEPTH_EXT     GL_MODELVIEW_STACK_DEPTH
#define GL_MODELVIEW1_STACK_DEPTH_EXT     0x8502
#define GL_MODELVIEW0_MATRIX_EXT          GL_MODELVIEW_MATRIX
#define GL_MODELVIEW1_MATRIX_EXT          0x8506
#define GL_VERTEX_WEIGHTING_EXT           0x8509
#define GL_MODELVIEW0_EXT                 GL_MODELVIEW
#define GL_MODELVIEW1_EXT                 0x850A
#define GL_CURRENT_VERTEX_WEIGHT_EXT      0x850B
#define GL_VERTEX_WEIGHT_ARRAY_EXT        0x850C
#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT   0x850D
#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT   0x850E
#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F
#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510
#endif

#ifndef GL_NV_light_max_exponent
#define GL_MAX_SHININESS_NV               0x8504
#define GL_MAX_SPOT_EXPONENT_NV           0x8505
#endif

#ifndef GL_NV_vertex_array_range
#define GL_VERTEX_ARRAY_RANGE_NV          0x851D
#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV   0x851E
#define GL_VERTEX_ARRAY_RANGE_VALID_NV    0x851F
#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520
#define GL_VERTEX_ARRAY_RANGE_POINTER_NV  0x8521
#endif

#ifndef GL_NV_register_combiners
#define GL_REGISTER_COMBINERS_NV          0x8522
#define GL_VARIABLE_A_NV                  0x8523
#define GL_VARIABLE_B_NV                  0x8524
#define GL_VARIABLE_C_NV                  0x8525
#define GL_VARIABLE_D_NV                  0x8526
#define GL_VARIABLE_E_NV                  0x8527
#define GL_VARIABLE_F_NV                  0x8528
#define GL_VARIABLE_G_NV                  0x8529
#define GL_CONSTANT_COLOR0_NV             0x852A
#define GL_CONSTANT_COLOR1_NV             0x852B
#define GL_PRIMARY_COLOR_NV               0x852C
#define GL_SECONDARY_COLOR_NV             0x852D
#define GL_SPARE0_NV                      0x852E
#define GL_SPARE1_NV                      0x852F
#define GL_DISCARD_NV                     0x8530
#define GL_E_TIMES_F_NV                   0x8531
#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532
#define GL_UNSIGNED_IDENTITY_NV           0x8536
#define GL_UNSIGNED_INVERT_NV             0x8537
#define GL_EXPAND_NORMAL_NV               0x8538
#define GL_EXPAND_NEGATE_NV               0x8539
#define GL_HALF_BIAS_NORMAL_NV            0x853A
#define GL_HALF_BIAS_NEGATE_NV            0x853B
#define GL_SIGNED_IDENTITY_NV             0x853C
#define GL_SIGNED_NEGATE_NV               0x853D
#define GL_SCALE_BY_TWO_NV                0x853E
#define GL_SCALE_BY_FOUR_NV               0x853F
#define GL_SCALE_BY_ONE_HALF_NV           0x8540
#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV   0x8541
#define GL_COMBINER_INPUT_NV              0x8542
#define GL_COMBINER_MAPPING_NV            0x8543
#define GL_COMBINER_COMPONENT_USAGE_NV    0x8544
#define GL_COMBINER_AB_DOT_PRODUCT_NV     0x8545
#define GL_COMBINER_CD_DOT_PRODUCT_NV     0x8546
#define GL_COMBINER_MUX_SUM_NV            0x8547
#define GL_COMBINER_SCALE_NV              0x8548
#define GL_COMBINER_BIAS_NV               0x8549
#define GL_COMBINER_AB_OUTPUT_NV          0x854A
#define GL_COMBINER_CD_OUTPUT_NV          0x854B
#define GL_COMBINER_SUM_OUTPUT_NV         0x854C
#define GL_MAX_GENERAL_COMBINERS_NV       0x854D
#define GL_NUM_GENERAL_COMBINERS_NV       0x854E
#define GL_COLOR_SUM_CLAMP_NV             0x854F
#define GL_COMBINER0_NV                   0x8550
#define GL_COMBINER1_NV                   0x8551
#define GL_COMBINER2_NV                   0x8552
#define GL_COMBINER3_NV                   0x8553
#define GL_COMBINER4_NV                   0x8554
#define GL_COMBINER5_NV                   0x8555
#define GL_COMBINER6_NV                   0x8556
#define GL_COMBINER7_NV                   0x8557
/* reuse GL_TEXTURE0_ARB */
/* reuse GL_TEXTURE1_ARB */
/* reuse GL_ZERO */
/* reuse GL_NONE */
/* reuse GL_FOG */
#endif

#ifndef GL_NV_fog_distance
#define GL_FOG_DISTANCE_MODE_NV           0x855A
#define GL_EYE_RADIAL_NV                  0x855B
#define GL_EYE_PLANE_ABSOLUTE_NV          0x855C
/* reuse GL_EYE_PLANE */
#endif

#ifndef GL_NV_texgen_emboss
#define GL_EMBOSS_LIGHT_NV                0x855D
#define GL_EMBOSS_CONSTANT_NV             0x855E
#define GL_EMBOSS_MAP_NV                  0x855F
#endif

#ifndef GL_NV_blend_square
#endif

#ifndef GL_NV_texture_env_combine4
#define GL_COMBINE4_NV                    0x8503
#define GL_SOURCE3_RGB_NV                 0x8583
#define GL_SOURCE3_ALPHA_NV               0x858B
#define GL_OPERAND3_RGB_NV                0x8593
#define GL_OPERAND3_ALPHA_NV              0x859B
#endif

#ifndef GL_MESA_resize_buffers
#endif

#ifndef GL_MESA_window_pos
#endif

#ifndef GL_EXT_texture_compression_s3tc
#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT   0x83F0
#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT  0x83F1
#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT  0x83F2
#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT  0x83F3
#endif

#ifndef GL_IBM_cull_vertex
#define GL_CULL_VERTEX_IBM                103050
#endif

#ifndef GL_IBM_multimode_draw_arrays
#endif

#ifndef GL_IBM_vertex_array_lists
#define GL_VERTEX_ARRAY_LIST_IBM          103070
#define GL_NORMAL_ARRAY_LIST_IBM          103071
#define GL_COLOR_ARRAY_LIST_IBM           103072
#define GL_INDEX_ARRAY_LIST_IBM           103073
#define GL_TEXTURE_COORD_ARRAY_LIST_IBM   103074
#define GL_EDGE_FLAG_ARRAY_LIST_IBM       103075
#define GL_FOG_COORDINATE_ARRAY_LIST_IBM  103076
#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077
#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM   103080
#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM   103081
#define GL_COLOR_ARRAY_LIST_STRIDE_IBM    103082
#define GL_INDEX_ARRAY_LIST_STRIDE_IBM    103083
#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084
#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085
#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086
#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087
#endif

#ifndef GL_SGIX_subsample
#define GL_PACK_SUBSAMPLE_RATE_SGIX       0x85A0
#define GL_UNPACK_SUBSAMPLE_RATE_SGIX     0x85A1
#define GL_PIXEL_SUBSAMPLE_4444_SGIX      0x85A2
#define GL_PIXEL_SUBSAMPLE_2424_SGIX      0x85A3
#define GL_PIXEL_SUBSAMPLE_4242_SGIX      0x85A4
#endif

#ifndef GL_SGIX_ycrcb_subsample
#endif

#ifndef GL_SGIX_ycrcba
#define GL_YCRCB_SGIX                     0x8318
#define GL_YCRCBA_SGIX                    0x8319
#endif

#ifndef GL_SGI_depth_pass_instrument
#define GL_DEPTH_PASS_INSTRUMENT_SGIX     0x8310
#define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311
#define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312
#endif

#ifndef GL_3DFX_texture_compression_FXT1
#define GL_COMPRESSED_RGB_FXT1_3DFX       0x86B0
#define GL_COMPRESSED_RGBA_FXT1_3DFX      0x86B1
#endif

#ifndef GL_3DFX_multisample
#define GL_MULTISAMPLE_3DFX               0x86B2
#define GL_SAMPLE_BUFFERS_3DFX            0x86B3
#define GL_SAMPLES_3DFX                   0x86B4
#define GL_MULTISAMPLE_BIT_3DFX           0x20000000
#endif

#ifndef GL_3DFX_tbuffer
#endif

#ifndef GL_EXT_multisample
#define GL_MULTISAMPLE_EXT                0x809D
#define GL_SAMPLE_ALPHA_TO_MASK_EXT       0x809E
#define GL_SAMPLE_ALPHA_TO_ONE_EXT        0x809F
#define GL_SAMPLE_MASK_EXT                0x80A0
#define GL_1PASS_EXT                      0x80A1
#define GL_2PASS_0_EXT                    0x80A2
#define GL_2PASS_1_EXT                    0x80A3
#define GL_4PASS_0_EXT                    0x80A4
#define GL_4PASS_1_EXT                    0x80A5
#define GL_4PASS_2_EXT                    0x80A6
#define GL_4PASS_3_EXT                    0x80A7
#define GL_SAMPLE_BUFFERS_EXT             0x80A8
#define GL_SAMPLES_EXT                    0x80A9
#define GL_SAMPLE_MASK_VALUE_EXT          0x80AA
#define GL_SAMPLE_MASK_INVERT_EXT         0x80AB
#define GL_SAMPLE_PATTERN_EXT             0x80AC
#define GL_MULTISAMPLE_BIT_EXT            0x20000000
#endif

#ifndef GL_SGIX_vertex_preclip
#define GL_VERTEX_PRECLIP_SGIX            0x83EE
#define GL_VERTEX_PRECLIP_HINT_SGIX       0x83EF
#endif

#ifndef GL_SGIX_convolution_accuracy
#define GL_CONVOLUTION_HINT_SGIX          0x8316
#endif

#ifndef GL_SGIX_resample
#define GL_PACK_RESAMPLE_SGIX             0x842C
#define GL_UNPACK_RESAMPLE_SGIX           0x842D
#define GL_RESAMPLE_REPLICATE_SGIX        0x842E
#define GL_RESAMPLE_ZERO_FILL_SGIX        0x842F
#define GL_RESAMPLE_DECIMATE_SGIX         0x8430
#endif

#ifndef GL_SGIS_point_line_texgen
#define GL_EYE_DISTANCE_TO_POINT_SGIS     0x81F0
#define GL_OBJECT_DISTANCE_TO_POINT_SGIS  0x81F1
#define GL_EYE_DISTANCE_TO_LINE_SGIS      0x81F2
#define GL_OBJECT_DISTANCE_TO_LINE_SGIS   0x81F3
#define GL_EYE_POINT_SGIS                 0x81F4
#define GL_OBJECT_POINT_SGIS              0x81F5
#define GL_EYE_LINE_SGIS                  0x81F6
#define GL_OBJECT_LINE_SGIS               0x81F7
#endif

#ifndef GL_SGIS_texture_color_mask
#define GL_TEXTURE_COLOR_WRITEMASK_SGIS   0x81EF
#endif

#ifndef GL_EXT_texture_env_dot3
#define GL_DOT3_RGB_EXT                   0x8740
#define GL_DOT3_RGBA_EXT                  0x8741
#endif

#ifndef GL_ATI_texture_mirror_once
#define GL_MIRROR_CLAMP_ATI               0x8742
#define GL_MIRROR_CLAMP_TO_EDGE_ATI       0x8743
#endif

#ifndef GL_NV_fence
#define GL_ALL_COMPLETED_NV               0x84F2
#define GL_FENCE_STATUS_NV                0x84F3
#define GL_FENCE_CONDITION_NV             0x84F4
#endif

#ifndef GL_IBM_texture_mirrored_repeat
#define GL_MIRRORED_REPEAT_IBM            0x8370
#endif

#ifndef GL_NV_evaluators
#define GL_EVAL_2D_NV                     0x86C0
#define GL_EVAL_TRIANGULAR_2D_NV          0x86C1
#define GL_MAP_TESSELLATION_NV            0x86C2
#define GL_MAP_ATTRIB_U_ORDER_NV          0x86C3
#define GL_MAP_ATTRIB_V_ORDER_NV          0x86C4
#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5
#define GL_EVAL_VERTEX_ATTRIB0_NV         0x86C6
#define GL_EVAL_VERTEX_ATTRIB1_NV         0x86C7
#define GL_EVAL_VERTEX_ATTRIB2_NV         0x86C8
#define GL_EVAL_VERTEX_ATTRIB3_NV         0x86C9
#define GL_EVAL_VERTEX_ATTRIB4_NV         0x86CA
#define GL_EVAL_VERTEX_ATTRIB5_NV         0x86CB
#define GL_EVAL_VERTEX_ATTRIB6_NV         0x86CC
#define GL_EVAL_VERTEX_ATTRIB7_NV         0x86CD
#define GL_EVAL_VERTEX_ATTRIB8_NV         0x86CE
#define GL_EVAL_VERTEX_ATTRIB9_NV         0x86CF
#define GL_EVAL_VERTEX_ATTRIB10_NV        0x86D0
#define GL_EVAL_VERTEX_ATTRIB11_NV        0x86D1
#define GL_EVAL_VERTEX_ATTRIB12_NV        0x86D2
#define GL_EVAL_VERTEX_ATTRIB13_NV        0x86D3
#define GL_EVAL_VERTEX_ATTRIB14_NV        0x86D4
#define GL_EVAL_VERTEX_ATTRIB15_NV        0x86D5
#define GL_MAX_MAP_TESSELLATION_NV        0x86D6
#define GL_MAX_RATIONAL_EVAL_ORDER_NV     0x86D7
#endif

#ifndef GL_NV_packed_depth_stencil
#define GL_DEPTH_STENCIL_NV               0x84F9
#define GL_UNSIGNED_INT_24_8_NV           0x84FA
#endif

#ifndef GL_NV_register_combiners2
#define GL_PER_STAGE_CONSTANTS_NV         0x8535
#endif

#ifndef GL_NV_texture_compression_vtc
#endif

#ifndef GL_NV_texture_rectangle
#define GL_TEXTURE_RECTANGLE_NV           0x84F5
#define GL_TEXTURE_BINDING_RECTANGLE_NV   0x84F6
#define GL_PROXY_TEXTURE_RECTANGLE_NV     0x84F7
#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV  0x84F8
#endif

#ifndef GL_NV_texture_shader
#define GL_OFFSET_TEXTURE_RECTANGLE_NV    0x864C
#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D
#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E
#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9
#define GL_UNSIGNED_INT_S8_S8_8_8_NV      0x86DA
#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV  0x86DB
#define GL_DSDT_MAG_INTENSITY_NV          0x86DC
#define GL_SHADER_CONSISTENT_NV           0x86DD
#define GL_TEXTURE_SHADER_NV              0x86DE
#define GL_SHADER_OPERATION_NV            0x86DF
#define GL_CULL_MODES_NV                  0x86E0
#define GL_OFFSET_TEXTURE_MATRIX_NV       0x86E1
#define GL_OFFSET_TEXTURE_SCALE_NV        0x86E2
#define GL_OFFSET_TEXTURE_BIAS_NV         0x86E3
#define GL_OFFSET_TEXTURE_2D_MATRIX_NV    GL_OFFSET_TEXTURE_MATRIX_NV
#define GL_OFFSET_TEXTURE_2D_SCALE_NV     GL_OFFSET_TEXTURE_SCALE_NV
#define GL_OFFSET_TEXTURE_2D_BIAS_NV      GL_OFFSET_TEXTURE_BIAS_NV
#define GL_PREVIOUS_TEXTURE_INPUT_NV      0x86E4
#define GL_CONST_EYE_NV                   0x86E5
#define GL_PASS_THROUGH_NV                0x86E6
#define GL_CULL_FRAGMENT_NV               0x86E7
#define GL_OFFSET_TEXTURE_2D_NV           0x86E8
#define GL_DEPENDENT_AR_TEXTURE_2D_NV     0x86E9
#define GL_DEPENDENT_GB_TEXTURE_2D_NV     0x86EA
#define GL_DOT_PRODUCT_NV                 0x86EC
#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV   0x86ED
#define GL_DOT_PRODUCT_TEXTURE_2D_NV      0x86EE
#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0
#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1
#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2
#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3
#define GL_HILO_NV                        0x86F4
#define GL_DSDT_NV                        0x86F5
#define GL_DSDT_MAG_NV                    0x86F6
#define GL_DSDT_MAG_VIB_NV                0x86F7
#define GL_HILO16_NV                      0x86F8
#define GL_SIGNED_HILO_NV                 0x86F9
#define GL_SIGNED_HILO16_NV               0x86FA
#define GL_SIGNED_RGBA_NV                 0x86FB
#define GL_SIGNED_RGBA8_NV                0x86FC
#define GL_SIGNED_RGB_NV                  0x86FE
#define GL_SIGNED_RGB8_NV                 0x86FF
#define GL_SIGNED_LUMINANCE_NV            0x8701
#define GL_SIGNED_LUMINANCE8_NV           0x8702
#define GL_SIGNED_LUMINANCE_ALPHA_NV      0x8703
#define GL_SIGNED_LUMINANCE8_ALPHA8_NV    0x8704
#define GL_SIGNED_ALPHA_NV                0x8705
#define GL_SIGNED_ALPHA8_NV               0x8706
#define GL_SIGNED_INTENSITY_NV            0x8707
#define GL_SIGNED_INTENSITY8_NV           0x8708
#define GL_DSDT8_NV                       0x8709
#define GL_DSDT8_MAG8_NV                  0x870A
#define GL_DSDT8_MAG8_INTENSITY8_NV       0x870B
#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV   0x870C
#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D
#define GL_HI_SCALE_NV                    0x870E
#define GL_LO_SCALE_NV                    0x870F
#define GL_DS_SCALE_NV                    0x8710
#define GL_DT_SCALE_NV                    0x8711
#define GL_MAGNITUDE_SCALE_NV             0x8712
#define GL_VIBRANCE_SCALE_NV              0x8713
#define GL_HI_BIAS_NV                     0x8714
#define GL_LO_BIAS_NV                     0x8715
#define GL_DS_BIAS_NV                     0x8716
#define GL_DT_BIAS_NV                     0x8717
#define GL_MAGNITUDE_BIAS_NV              0x8718
#define GL_VIBRANCE_BIAS_NV               0x8719
#define GL_TEXTURE_BORDER_VALUES_NV       0x871A
#define GL_TEXTURE_HI_SIZE_NV             0x871B
#define GL_TEXTURE_LO_SIZE_NV             0x871C
#define GL_TEXTURE_DS_SIZE_NV             0x871D
#define GL_TEXTURE_DT_SIZE_NV             0x871E
#define GL_TEXTURE_MAG_SIZE_NV            0x871F
#endif

#ifndef GL_NV_texture_shader2
#define GL_DOT_PRODUCT_TEXTURE_3D_NV      0x86EF
#endif

#ifndef GL_NV_vertex_array_range2
#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533
#endif

#ifndef GL_NV_vertex_program
#define GL_VERTEX_PROGRAM_NV              0x8620
#define GL_VERTEX_STATE_PROGRAM_NV        0x8621
#define GL_ATTRIB_ARRAY_SIZE_NV           0x8623
#define GL_ATTRIB_ARRAY_STRIDE_NV         0x8624
#define GL_ATTRIB_ARRAY_TYPE_NV           0x8625
#define GL_CURRENT_ATTRIB_NV              0x8626
#define GL_PROGRAM_LENGTH_NV              0x8627
#define GL_PROGRAM_STRING_NV              0x8628
#define GL_MODELVIEW_PROJECTION_NV        0x8629
#define GL_IDENTITY_NV                    0x862A
#define GL_INVERSE_NV                     0x862B
#define GL_TRANSPOSE_NV                   0x862C
#define GL_INVERSE_TRANSPOSE_NV           0x862D
#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E
#define GL_MAX_TRACK_MATRICES_NV          0x862F
#define GL_MATRIX0_NV                     0x8630
#define GL_MATRIX1_NV                     0x8631
#define GL_MATRIX2_NV                     0x8632
#define GL_MATRIX3_NV                     0x8633
#define GL_MATRIX4_NV                     0x8634
#define GL_MATRIX5_NV                     0x8635
#define GL_MATRIX6_NV                     0x8636
#define GL_MATRIX7_NV                     0x8637
#define GL_CURRENT_MATRIX_STACK_DEPTH_NV  0x8640
#define GL_CURRENT_MATRIX_NV              0x8641
#define GL_VERTEX_PROGRAM_POINT_SIZE_NV   0x8642
#define GL_VERTEX_PROGRAM_TWO_SIDE_NV     0x8643
#define GL_PROGRAM_PARAMETER_NV           0x8644
#define GL_ATTRIB_ARRAY_POINTER_NV        0x8645
#define GL_PROGRAM_TARGET_NV              0x8646
#define GL_PROGRAM_RESIDENT_NV            0x8647
#define GL_TRACK_MATRIX_NV                0x8648
#define GL_TRACK_MATRIX_TRANSFORM_NV      0x8649
#define GL_VERTEX_PROGRAM_BINDING_NV      0x864A
#define GL_PROGRAM_ERROR_POSITION_NV      0x864B
#define GL_VERTEX_ATTRIB_ARRAY0_NV        0x8650
#define GL_VERTEX_ATTRIB_ARRAY1_NV        0x8651
#define GL_VERTEX_ATTRIB_ARRAY2_NV        0x8652
#define GL_VERTEX_ATTRIB_ARRAY3_NV        0x8653
#define GL_VERTEX_ATTRIB_ARRAY4_NV        0x8654
#define GL_VERTEX_ATTRIB_ARRAY5_NV        0x8655
#define GL_VERTEX_ATTRIB_ARRAY6_NV        0x8656
#define GL_VERTEX_ATTRIB_ARRAY7_NV        0x8657
#define GL_VERTEX_ATTRIB_ARRAY8_NV        0x8658
#define GL_VERTEX_ATTRIB_ARRAY9_NV        0x8659
#define GL_VERTEX_ATTRIB_ARRAY10_NV       0x865A
#define GL_VERTEX_ATTRIB_ARRAY11_NV       0x865B
#define GL_VERTEX_ATTRIB_ARRAY12_NV       0x865C
#define GL_VERTEX_ATTRIB_ARRAY13_NV       0x865D
#define GL_VERTEX_ATTRIB_ARRAY14_NV       0x865E
#define GL_VERTEX_ATTRIB_ARRAY15_NV       0x865F
#define GL_MAP1_VERTEX_ATTRIB0_4_NV       0x8660
#define GL_MAP1_VERTEX_ATTRIB1_4_NV       0x8661
#define GL_MAP1_VERTEX_ATTRIB2_4_NV       0x8662
#define GL_MAP1_VERTEX_ATTRIB3_4_NV       0x8663
#define GL_MAP1_VERTEX_ATTRIB4_4_NV       0x8664
#define GL_MAP1_VERTEX_ATTRIB5_4_NV       0x8665
#define GL_MAP1_VERTEX_ATTRIB6_4_NV       0x8666
#define GL_MAP1_VERTEX_ATTRIB7_4_NV       0x8667
#define GL_MAP1_VERTEX_ATTRIB8_4_NV       0x8668
#define GL_MAP1_VERTEX_ATTRIB9_4_NV       0x8669
#define GL_MAP1_VERTEX_ATTRIB10_4_NV      0x866A
#define GL_MAP1_VERTEX_ATTRIB11_4_NV      0x866B
#define GL_MAP1_VERTEX_ATTRIB12_4_NV      0x866C
#define GL_MAP1_VERTEX_ATTRIB13_4_NV      0x866D
#define GL_MAP1_VERTEX_ATTRIB14_4_NV      0x866E
#define GL_MAP1_VERTEX_ATTRIB15_4_NV      0x866F
#define GL_MAP2_VERTEX_ATTRIB0_4_NV       0x8670
#define GL_MAP2_VERTEX_ATTRIB1_4_NV       0x8671
#define GL_MAP2_VERTEX_ATTRIB2_4_NV       0x8672
#define GL_MAP2_VERTEX_ATTRIB3_4_NV       0x8673
#define GL_MAP2_VERTEX_ATTRIB4_4_NV       0x8674
#define GL_MAP2_VERTEX_ATTRIB5_4_NV       0x8675
#define GL_MAP2_VERTEX_ATTRIB6_4_NV       0x8676
#define GL_MAP2_VERTEX_ATTRIB7_4_NV       0x8677
#define GL_MAP2_VERTEX_ATTRIB8_4_NV       0x8678
#define GL_MAP2_VERTEX_ATTRIB9_4_NV       0x8679
#define GL_MAP2_VERTEX_ATTRIB10_4_NV      0x867A
#define GL_MAP2_VERTEX_ATTRIB11_4_NV      0x867B
#define GL_MAP2_VERTEX_ATTRIB12_4_NV      0x867C
#define GL_MAP2_VERTEX_ATTRIB13_4_NV      0x867D
#define GL_MAP2_VERTEX_ATTRIB14_4_NV      0x867E
#define GL_MAP2_VERTEX_ATTRIB15_4_NV      0x867F
#endif

#ifndef GL_SGIX_texture_coordinate_clamp
#define GL_TEXTURE_MAX_CLAMP_S_SGIX       0x8369
#define GL_TEXTURE_MAX_CLAMP_T_SGIX       0x836A
#define GL_TEXTURE_MAX_CLAMP_R_SGIX       0x836B
#endif

#ifndef GL_SGIX_scalebias_hint
#define GL_SCALEBIAS_HINT_SGIX            0x8322
#endif

#ifndef GL_OML_interlace
#define GL_INTERLACE_OML                  0x8980
#define GL_INTERLACE_READ_OML             0x8981
#endif

#ifndef GL_OML_subsample
#define GL_FORMAT_SUBSAMPLE_24_24_OML     0x8982
#define GL_FORMAT_SUBSAMPLE_244_244_OML   0x8983
#endif

#ifndef GL_OML_resample
#define GL_PACK_RESAMPLE_OML              0x8984
#define GL_UNPACK_RESAMPLE_OML            0x8985
#define GL_RESAMPLE_REPLICATE_OML         0x8986
#define GL_RESAMPLE_ZERO_FILL_OML         0x8987
#define GL_RESAMPLE_AVERAGE_OML           0x8988
#define GL_RESAMPLE_DECIMATE_OML          0x8989
#endif

#ifndef GL_NV_copy_depth_to_color
#define GL_DEPTH_STENCIL_TO_RGBA_NV       0x886E
#define GL_DEPTH_STENCIL_TO_BGRA_NV       0x886F
#endif

#ifndef GL_ATI_envmap_bumpmap
#define GL_BUMP_ROT_MATRIX_ATI            0x8775
#define GL_BUMP_ROT_MATRIX_SIZE_ATI       0x8776
#define GL_BUMP_NUM_TEX_UNITS_ATI         0x8777
#define GL_BUMP_TEX_UNITS_ATI             0x8778
#define GL_DUDV_ATI                       0x8779
#define GL_DU8DV8_ATI                     0x877A
#define GL_BUMP_ENVMAP_ATI                0x877B
#define GL_BUMP_TARGET_ATI                0x877C
#endif

#ifndef GL_ATI_fragment_shader
#define GL_FRAGMENT_SHADER_ATI            0x8920
#define GL_REG_0_ATI                      0x8921
#define GL_REG_1_ATI                      0x8922
#define GL_REG_2_ATI                      0x8923
#define GL_REG_3_ATI                      0x8924
#define GL_REG_4_ATI                      0x8925
#define GL_REG_5_ATI                      0x8926
#define GL_REG_6_ATI                      0x8927
#define GL_REG_7_ATI                      0x8928
#define GL_REG_8_ATI                      0x8929
#define GL_REG_9_ATI                      0x892A
#define GL_REG_10_ATI                     0x892B
#define GL_REG_11_ATI                     0x892C
#define GL_REG_12_ATI                     0x892D
#define GL_REG_13_ATI                     0x892E
#define GL_REG_14_ATI                     0x892F
#define GL_REG_15_ATI                     0x8930
#define GL_REG_16_ATI                     0x8931
#define GL_REG_17_ATI                     0x8932
#define GL_REG_18_ATI                     0x8933
#define GL_REG_19_ATI                     0x8934
#define GL_REG_20_ATI                     0x8935
#define GL_REG_21_ATI                     0x8936
#define GL_REG_22_ATI                     0x8937
#define GL_REG_23_ATI                     0x8938
#define GL_REG_24_ATI                     0x8939
#define GL_REG_25_ATI                     0x893A
#define GL_REG_26_ATI                     0x893B
#define GL_REG_27_ATI                     0x893C
#define GL_REG_28_ATI                     0x893D
#define GL_REG_29_ATI                     0x893E
#define GL_REG_30_ATI                     0x893F
#define GL_REG_31_ATI                     0x8940
#define GL_CON_0_ATI                      0x8941
#define GL_CON_1_ATI                      0x8942
#define GL_CON_2_ATI                      0x8943
#define GL_CON_3_ATI                      0x8944
#define GL_CON_4_ATI                      0x8945
#define GL_CON_5_ATI                      0x8946
#define GL_CON_6_ATI                      0x8947
#define GL_CON_7_ATI                      0x8948
#define GL_CON_8_ATI                      0x8949
#define GL_CON_9_ATI                      0x894A
#define GL_CON_10_ATI                     0x894B
#define GL_CON_11_ATI                     0x894C
#define GL_CON_12_ATI                     0x894D
#define GL_CON_13_ATI                     0x894E
#define GL_CON_14_ATI                     0x894F
#define GL_CON_15_ATI                     0x8950
#define GL_CON_16_ATI                     0x8951
#define GL_CON_17_ATI                     0x8952
#define GL_CON_18_ATI                     0x8953
#define GL_CON_19_ATI                     0x8954
#define GL_CON_20_ATI                     0x8955
#define GL_CON_21_ATI                     0x8956
#define GL_CON_22_ATI                     0x8957
#define GL_CON_23_ATI                     0x8958
#define GL_CON_24_ATI                     0x8959
#define GL_CON_25_ATI                     0x895A
#define GL_CON_26_ATI                     0x895B
#define GL_CON_27_ATI                     0x895C
#define GL_CON_28_ATI                     0x895D
#define GL_CON_29_ATI                     0x895E
#define GL_CON_30_ATI                     0x895F
#define GL_CON_31_ATI                     0x8960
#define GL_MOV_ATI                        0x8961
#define GL_ADD_ATI                        0x8963
#define GL_MUL_ATI                        0x8964
#define GL_SUB_ATI                        0x8965
#define GL_DOT3_ATI                       0x8966
#define GL_DOT4_ATI                       0x8967
#define GL_MAD_ATI                        0x8968
#define GL_LERP_ATI                       0x8969
#define GL_CND_ATI                        0x896A
#define GL_CND0_ATI                       0x896B
#define GL_DOT2_ADD_ATI                   0x896C
#define GL_SECONDARY_INTERPOLATOR_ATI     0x896D
#define GL_NUM_FRAGMENT_REGISTERS_ATI     0x896E
#define GL_NUM_FRAGMENT_CONSTANTS_ATI     0x896F
#define GL_NUM_PASSES_ATI                 0x8970
#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI  0x8971
#define GL_NUM_INSTRUCTIONS_TOTAL_ATI     0x8972
#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973
#define GL_NUM_LOOPBACK_COMPONENTS_ATI    0x8974
#define GL_COLOR_ALPHA_PAIRING_ATI        0x8975
#define GL_SWIZZLE_STR_ATI                0x8976
#define GL_SWIZZLE_STQ_ATI                0x8977
#define GL_SWIZZLE_STR_DR_ATI             0x8978
#define GL_SWIZZLE_STQ_DQ_ATI             0x8979
#define GL_SWIZZLE_STRQ_ATI               0x897A
#define GL_SWIZZLE_STRQ_DQ_ATI            0x897B
#define GL_RED_BIT_ATI                    0x00000001
#define GL_GREEN_BIT_ATI                  0x00000002
#define GL_BLUE_BIT_ATI                   0x00000004
#define GL_2X_BIT_ATI                     0x00000001
#define GL_4X_BIT_ATI                     0x00000002
#define GL_8X_BIT_ATI                     0x00000004
#define GL_HALF_BIT_ATI                   0x00000008
#define GL_QUARTER_BIT_ATI                0x00000010
#define GL_EIGHTH_BIT_ATI                 0x00000020
#define GL_SATURATE_BIT_ATI               0x00000040
#define GL_COMP_BIT_ATI                   0x00000002
#define GL_NEGATE_BIT_ATI                 0x00000004
#define GL_BIAS_BIT_ATI                   0x00000008
#endif

#ifndef GL_ATI_pn_triangles
#define GL_PN_TRIANGLES_ATI               0x87F0
#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1
#define GL_PN_TRIANGLES_POINT_MODE_ATI    0x87F2
#define GL_PN_TRIANGLES_NORMAL_MODE_ATI   0x87F3
#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4
#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5
#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6
#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7
#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8
#endif

#ifndef GL_ATI_vertex_array_object
#define GL_STATIC_ATI                     0x8760
#define GL_DYNAMIC_ATI                    0x8761
#define GL_PRESERVE_ATI                   0x8762
#define GL_DISCARD_ATI                    0x8763
#define GL_OBJECT_BUFFER_SIZE_ATI         0x8764
#define GL_OBJECT_BUFFER_USAGE_ATI        0x8765
#define GL_ARRAY_OBJECT_BUFFER_ATI        0x8766
#define GL_ARRAY_OBJECT_OFFSET_ATI        0x8767
#endif

#ifndef GL_EXT_vertex_shader
#define GL_VERTEX_SHADER_EXT              0x8780
#define GL_VERTEX_SHADER_BINDING_EXT      0x8781
#define GL_OP_INDEX_EXT                   0x8782
#define GL_OP_NEGATE_EXT                  0x8783
#define GL_OP_DOT3_EXT                    0x8784
#define GL_OP_DOT4_EXT                    0x8785
#define GL_OP_MUL_EXT                     0x8786
#define GL_OP_ADD_EXT                     0x8787
#define GL_OP_MADD_EXT                    0x8788
#define GL_OP_FRAC_EXT                    0x8789
#define GL_OP_MAX_EXT                     0x878A
#define GL_OP_MIN_EXT                     0x878B
#define GL_OP_SET_GE_EXT                  0x878C
#define GL_OP_SET_LT_EXT                  0x878D
#define GL_OP_CLAMP_EXT                   0x878E
#define GL_OP_FLOOR_EXT                   0x878F
#define GL_OP_ROUND_EXT                   0x8790
#define GL_OP_EXP_BASE_2_EXT              0x8791
#define GL_OP_LOG_BASE_2_EXT              0x8792
#define GL_OP_POWER_EXT                   0x8793
#define GL_OP_RECIP_EXT                   0x8794
#define GL_OP_RECIP_SQRT_EXT              0x8795
#define GL_OP_SUB_EXT                     0x8796
#define GL_OP_CROSS_PRODUCT_EXT           0x8797
#define GL_OP_MULTIPLY_MATRIX_EXT         0x8798
#define GL_OP_MOV_EXT                     0x8799
#define GL_OUTPUT_VERTEX_EXT              0x879A
#define GL_OUTPUT_COLOR0_EXT              0x879B
#define GL_OUTPUT_COLOR1_EXT              0x879C
#define GL_OUTPUT_TEXTURE_COORD0_EXT      0x879D
#define GL_OUTPUT_TEXTURE_COORD1_EXT      0x879E
#define GL_OUTPUT_TEXTURE_COORD2_EXT      0x879F
#define GL_OUTPUT_TEXTURE_COORD3_EXT      0x87A0
#define GL_OUTPUT_TEXTURE_COORD4_EXT      0x87A1
#define GL_OUTPUT_TEXTURE_COORD5_EXT      0x87A2
#define GL_OUTPUT_TEXTURE_COORD6_EXT      0x87A3
#define GL_OUTPUT_TEXTURE_COORD7_EXT      0x87A4
#define GL_OUTPUT_TEXTURE_COORD8_EXT      0x87A5
#define GL_OUTPUT_TEXTURE_COORD9_EXT      0x87A6
#define GL_OUTPUT_TEXTURE_COORD10_EXT     0x87A7
#define GL_OUTPUT_TEXTURE_COORD11_EXT     0x87A8
#define GL_OUTPUT_TEXTURE_COORD12_EXT     0x87A9
#define GL_OUTPUT_TEXTURE_COORD13_EXT     0x87AA
#define GL_OUTPUT_TEXTURE_COORD14_EXT     0x87AB
#define GL_OUTPUT_TEXTURE_COORD15_EXT     0x87AC
#define GL_OUTPUT_TEXTURE_COORD16_EXT     0x87AD
#define GL_OUTPUT_TEXTURE_COORD17_EXT     0x87AE
#define GL_OUTPUT_TEXTURE_COORD18_EXT     0x87AF
#define GL_OUTPUT_TEXTURE_COORD19_EXT     0x87B0
#define GL_OUTPUT_TEXTURE_COORD20_EXT     0x87B1
#define GL_OUTPUT_TEXTURE_COORD21_EXT     0x87B2
#define GL_OUTPUT_TEXTURE_COORD22_EXT     0x87B3
#define GL_OUTPUT_TEXTURE_COORD23_EXT     0x87B4
#define GL_OUTPUT_TEXTURE_COORD24_EXT     0x87B5
#define GL_OUTPUT_TEXTURE_COORD25_EXT     0x87B6
#define GL_OUTPUT_TEXTURE_COORD26_EXT     0x87B7
#define GL_OUTPUT_TEXTURE_COORD27_EXT     0x87B8
#define GL_OUTPUT_TEXTURE_COORD28_EXT     0x87B9
#define GL_OUTPUT_TEXTURE_COORD29_EXT     0x87BA
#define GL_OUTPUT_TEXTURE_COORD30_EXT     0x87BB
#define GL_OUTPUT_TEXTURE_COORD31_EXT     0x87BC
#define GL_OUTPUT_FOG_EXT                 0x87BD
#define GL_SCALAR_EXT                     0x87BE
#define GL_VECTOR_EXT                     0x87BF
#define GL_MATRIX_EXT                     0x87C0
#define GL_VARIANT_EXT                    0x87C1
#define GL_INVARIANT_EXT                  0x87C2
#define GL_LOCAL_CONSTANT_EXT             0x87C3
#define GL_LOCAL_EXT                      0x87C4
#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5
#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6
#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7
#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8
#define GL_MAX_VERTEX_SHADER_LOCALS_EXT   0x87C9
#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA
#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB
#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC
#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD
#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE
#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF
#define GL_VERTEX_SHADER_VARIANTS_EXT     0x87D0
#define GL_VERTEX_SHADER_INVARIANTS_EXT   0x87D1
#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2
#define GL_VERTEX_SHADER_LOCALS_EXT       0x87D3
#define GL_VERTEX_SHADER_OPTIMIZED_EXT    0x87D4
#define GL_X_EXT                          0x87D5
#define GL_Y_EXT                          0x87D6
#define GL_Z_EXT                          0x87D7
#define GL_W_EXT                          0x87D8
#define GL_NEGATIVE_X_EXT                 0x87D9
#define GL_NEGATIVE_Y_EXT                 0x87DA
#define GL_NEGATIVE_Z_EXT                 0x87DB
#define GL_NEGATIVE_W_EXT                 0x87DC
#define GL_ZERO_EXT                       0x87DD
#define GL_ONE_EXT                        0x87DE
#define GL_NEGATIVE_ONE_EXT               0x87DF
#define GL_NORMALIZED_RANGE_EXT           0x87E0
#define GL_FULL_RANGE_EXT                 0x87E1
#define GL_CURRENT_VERTEX_EXT             0x87E2
#define GL_MVP_MATRIX_EXT                 0x87E3
#define GL_VARIANT_VALUE_EXT              0x87E4
#define GL_VARIANT_DATATYPE_EXT           0x87E5
#define GL_VARIANT_ARRAY_STRIDE_EXT       0x87E6
#define GL_VARIANT_ARRAY_TYPE_EXT         0x87E7
#define GL_VARIANT_ARRAY_EXT              0x87E8
#define GL_VARIANT_ARRAY_POINTER_EXT      0x87E9
#define GL_INVARIANT_VALUE_EXT            0x87EA
#define GL_INVARIANT_DATATYPE_EXT         0x87EB
#define GL_LOCAL_CONSTANT_VALUE_EXT       0x87EC
#define GL_LOCAL_CONSTANT_DATATYPE_EXT    0x87ED
#endif

#ifndef GL_ATI_vertex_streams
#define GL_MAX_VERTEX_STREAMS_ATI         0x876B
#define GL_VERTEX_STREAM0_ATI             0x876C
#define GL_VERTEX_STREAM1_ATI             0x876D
#define GL_VERTEX_STREAM2_ATI             0x876E
#define GL_VERTEX_STREAM3_ATI             0x876F
#define GL_VERTEX_STREAM4_ATI             0x8770
#define GL_VERTEX_STREAM5_ATI             0x8771
#define GL_VERTEX_STREAM6_ATI             0x8772
#define GL_VERTEX_STREAM7_ATI             0x8773
#define GL_VERTEX_SOURCE_ATI              0x8774
#endif

#ifndef GL_ATI_element_array
#define GL_ELEMENT_ARRAY_ATI              0x8768
#define GL_ELEMENT_ARRAY_TYPE_ATI         0x8769
#define GL_ELEMENT_ARRAY_POINTER_ATI      0x876A
#endif

#ifndef GL_SUN_mesh_array
#define GL_QUAD_MESH_SUN                  0x8614
#define GL_TRIANGLE_MESH_SUN              0x8615
#endif

#ifndef GL_SUN_slice_accum
#define GL_SLICE_ACCUM_SUN                0x85CC
#endif

#ifndef GL_NV_multisample_filter_hint
#define GL_MULTISAMPLE_FILTER_HINT_NV     0x8534
#endif

#ifndef GL_NV_depth_clamp
#define GL_DEPTH_CLAMP_NV                 0x864F
#endif

#ifndef GL_NV_occlusion_query
#define GL_PIXEL_COUNTER_BITS_NV          0x8864
#define GL_CURRENT_OCCLUSION_QUERY_ID_NV  0x8865
#define GL_PIXEL_COUNT_NV                 0x8866
#define GL_PIXEL_COUNT_AVAILABLE_NV       0x8867
#endif

#ifndef GL_NV_point_sprite
#define GL_POINT_SPRITE_NV                0x8861
#define GL_COORD_REPLACE_NV               0x8862
#define GL_POINT_SPRITE_R_MODE_NV         0x8863
#endif

#ifndef GL_NV_texture_shader3
#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850
#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851
#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852
#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853
#define GL_OFFSET_HILO_TEXTURE_2D_NV      0x8854
#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855
#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856
#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857
#define GL_DEPENDENT_HILO_TEXTURE_2D_NV   0x8858
#define GL_DEPENDENT_RGB_TEXTURE_3D_NV    0x8859
#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A
#define GL_DOT_PRODUCT_PASS_THROUGH_NV    0x885B
#define GL_DOT_PRODUCT_TEXTURE_1D_NV      0x885C
#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D
#define GL_HILO8_NV                       0x885E
#define GL_SIGNED_HILO8_NV                0x885F
#define GL_FORCE_BLUE_TO_ONE_NV           0x8860
#endif

#ifndef GL_NV_vertex_program1_1
#endif

#ifndef GL_EXT_shadow_funcs
#endif

#ifndef GL_EXT_stencil_two_side
#define GL_STENCIL_TEST_TWO_SIDE_EXT      0x8910
#define GL_ACTIVE_STENCIL_FACE_EXT        0x8911
#endif

#ifndef GL_ATI_text_fragment_shader
#define GL_TEXT_FRAGMENT_SHADER_ATI       0x8200
#endif

#ifndef GL_APPLE_client_storage
#define GL_UNPACK_CLIENT_STORAGE_APPLE    0x85B2
#endif

#ifndef GL_APPLE_element_array
#define GL_ELEMENT_ARRAY_APPLE            0x8768
#define GL_ELEMENT_ARRAY_TYPE_APPLE       0x8769
#define GL_ELEMENT_ARRAY_POINTER_APPLE    0x876A
#endif

#ifndef GL_APPLE_fence
#define GL_DRAW_PIXELS_APPLE              0x8A0A
#define GL_FENCE_APPLE                    0x8A0B
#endif

#ifndef GL_APPLE_vertex_array_object
#define GL_VERTEX_ARRAY_BINDING_APPLE     0x85B5
#endif

#ifndef GL_APPLE_vertex_array_range
#define GL_VERTEX_ARRAY_RANGE_APPLE       0x851D
#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E
#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F
#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521
#define GL_STORAGE_CACHED_APPLE           0x85BE
#define GL_STORAGE_SHARED_APPLE           0x85BF
#endif

#ifndef GL_APPLE_ycbcr_422
#define GL_YCBCR_422_APPLE                0x85B9
#define GL_UNSIGNED_SHORT_8_8_APPLE       0x85BA
#define GL_UNSIGNED_SHORT_8_8_REV_APPLE   0x85BB
#endif

#ifndef GL_S3_s3tc
#define GL_RGB_S3TC                       0x83A0
#define GL_RGB4_S3TC                      0x83A1
#define GL_RGBA_S3TC                      0x83A2
#define GL_RGBA4_S3TC                     0x83A3
#endif

#ifndef GL_ATI_draw_buffers
#define GL_MAX_DRAW_BUFFERS_ATI           0x8824
#define GL_DRAW_BUFFER0_ATI               0x8825
#define GL_DRAW_BUFFER1_ATI               0x8826
#define GL_DRAW_BUFFER2_ATI               0x8827
#define GL_DRAW_BUFFER3_ATI               0x8828
#define GL_DRAW_BUFFER4_ATI               0x8829
#define GL_DRAW_BUFFER5_ATI               0x882A
#define GL_DRAW_BUFFER6_ATI               0x882B
#define GL_DRAW_BUFFER7_ATI               0x882C
#define GL_DRAW_BUFFER8_ATI               0x882D
#define GL_DRAW_BUFFER9_ATI               0x882E
#define GL_DRAW_BUFFER10_ATI              0x882F
#define GL_DRAW_BUFFER11_ATI              0x8830
#define GL_DRAW_BUFFER12_ATI              0x8831
#define GL_DRAW_BUFFER13_ATI              0x8832
#define GL_DRAW_BUFFER14_ATI              0x8833
#define GL_DRAW_BUFFER15_ATI              0x8834
#endif

#ifndef GL_ATI_pixel_format_float
#define GL_TYPE_RGBA_FLOAT_ATI            0x8820
#define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835
#endif

#ifndef GL_ATI_texture_env_combine3
#define GL_MODULATE_ADD_ATI               0x8744
#define GL_MODULATE_SIGNED_ADD_ATI        0x8745
#define GL_MODULATE_SUBTRACT_ATI          0x8746
#endif

#ifndef GL_ATI_texture_float
#define GL_RGBA_FLOAT32_ATI               0x8814
#define GL_RGB_FLOAT32_ATI                0x8815
#define GL_ALPHA_FLOAT32_ATI              0x8816
#define GL_INTENSITY_FLOAT32_ATI          0x8817
#define GL_LUMINANCE_FLOAT32_ATI          0x8818
#define GL_LUMINANCE_ALPHA_FLOAT32_ATI    0x8819
#define GL_RGBA_FLOAT16_ATI               0x881A
#define GL_RGB_FLOAT16_ATI                0x881B
#define GL_ALPHA_FLOAT16_ATI              0x881C
#define GL_INTENSITY_FLOAT16_ATI          0x881D
#define GL_LUMINANCE_FLOAT16_ATI          0x881E
#define GL_LUMINANCE_ALPHA_FLOAT16_ATI    0x881F
#endif

#ifndef GL_NV_float_buffer
#define GL_FLOAT_R_NV                     0x8880
#define GL_FLOAT_RG_NV                    0x8881
#define GL_FLOAT_RGB_NV                   0x8882
#define GL_FLOAT_RGBA_NV                  0x8883
#define GL_FLOAT_R16_NV                   0x8884
#define GL_FLOAT_R32_NV                   0x8885
#define GL_FLOAT_RG16_NV                  0x8886
#define GL_FLOAT_RG32_NV                  0x8887
#define GL_FLOAT_RGB16_NV                 0x8888
#define GL_FLOAT_RGB32_NV                 0x8889
#define GL_FLOAT_RGBA16_NV                0x888A
#define GL_FLOAT_RGBA32_NV                0x888B
#define GL_TEXTURE_FLOAT_COMPONENTS_NV    0x888C
#define GL_FLOAT_CLEAR_COLOR_VALUE_NV     0x888D
#define GL_FLOAT_RGBA_MODE_NV             0x888E
#endif

#ifndef GL_NV_fragment_program
#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868
#define GL_FRAGMENT_PROGRAM_NV            0x8870
#define GL_MAX_TEXTURE_COORDS_NV          0x8871
#define GL_MAX_TEXTURE_IMAGE_UNITS_NV     0x8872
#define GL_FRAGMENT_PROGRAM_BINDING_NV    0x8873
#define GL_PROGRAM_ERROR_STRING_NV        0x8874
#endif

#ifndef GL_NV_half_float
#define GL_HALF_FLOAT_NV                  0x140B
#endif

#ifndef GL_NV_pixel_data_range
#define GL_WRITE_PIXEL_DATA_RANGE_NV      0x8878
#define GL_READ_PIXEL_DATA_RANGE_NV       0x8879
#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A
#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B
#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C
#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D
#endif

#ifndef GL_NV_primitive_restart
#define GL_PRIMITIVE_RESTART_NV           0x8558
#define GL_PRIMITIVE_RESTART_INDEX_NV     0x8559
#endif

#ifndef GL_NV_texture_expand_normal
#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F
#endif

#ifndef GL_NV_vertex_program2
#endif

#ifndef GL_ATI_map_object_buffer
#endif

#ifndef GL_ATI_separate_stencil
#define GL_STENCIL_BACK_FUNC_ATI          0x8800
#define GL_STENCIL_BACK_FAIL_ATI          0x8801
#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802
#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803
#endif

#ifndef GL_ATI_vertex_attrib_array_object
#endif

#ifndef GL_OES_read_format
#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A
#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B
#endif

#ifndef GL_EXT_depth_bounds_test
#define GL_DEPTH_BOUNDS_TEST_EXT          0x8890
#define GL_DEPTH_BOUNDS_EXT               0x8891
#endif

#ifndef GL_EXT_texture_mirror_clamp
#define GL_MIRROR_CLAMP_EXT               0x8742
#define GL_MIRROR_CLAMP_TO_EDGE_EXT       0x8743
#define GL_MIRROR_CLAMP_TO_BORDER_EXT     0x8912
#endif

#ifndef GL_EXT_blend_equation_separate
#define GL_BLEND_EQUATION_RGB_EXT         GL_BLEND_EQUATION
#define GL_BLEND_EQUATION_ALPHA_EXT       0x883D
#endif

#ifndef GL_MESA_pack_invert
#define GL_PACK_INVERT_MESA               0x8758
#endif

#ifndef GL_MESA_ycbcr_texture
#define GL_UNSIGNED_SHORT_8_8_MESA        0x85BA
#define GL_UNSIGNED_SHORT_8_8_REV_MESA    0x85BB
#define GL_YCBCR_MESA                     0x8757
#endif

#ifndef GL_EXT_pixel_buffer_object
#define GL_PIXEL_PACK_BUFFER_EXT          0x88EB
#define GL_PIXEL_UNPACK_BUFFER_EXT        0x88EC
#define GL_PIXEL_PACK_BUFFER_BINDING_EXT  0x88ED
#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF
#endif

#ifndef GL_NV_fragment_program_option
#endif

#ifndef GL_NV_fragment_program2
#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4
#define GL_MAX_PROGRAM_CALL_DEPTH_NV      0x88F5
#define GL_MAX_PROGRAM_IF_DEPTH_NV        0x88F6
#define GL_MAX_PROGRAM_LOOP_DEPTH_NV      0x88F7
#define GL_MAX_PROGRAM_LOOP_COUNT_NV      0x88F8
#endif

#ifndef GL_NV_vertex_program2_option
/* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */
/* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */
#endif

#ifndef GL_NV_vertex_program3
/* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */
#endif

#ifndef GL_EXT_framebuffer_object
#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506
#define GL_MAX_RENDERBUFFER_SIZE_EXT      0x84E8
#define GL_FRAMEBUFFER_BINDING_EXT        0x8CA6
#define GL_RENDERBUFFER_BINDING_EXT       0x8CA7
#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0
#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1
#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2
#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3
#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4
#define GL_FRAMEBUFFER_COMPLETE_EXT       0x8CD5
#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6
#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7
#define GL_FRAMEBUFFER_INCOMPLETE_DUPLICATE_ATTACHMENT_EXT 0x8CD8
#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9
#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA
#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB
#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC
#define GL_FRAMEBUFFER_UNSUPPORTED_EXT    0x8CDD
#define GL_MAX_COLOR_ATTACHMENTS_EXT      0x8CDF
#define GL_COLOR_ATTACHMENT0_EXT          0x8CE0
#define GL_COLOR_ATTACHMENT1_EXT          0x8CE1
#define GL_COLOR_ATTACHMENT2_EXT          0x8CE2
#define GL_COLOR_ATTACHMENT3_EXT          0x8CE3
#define GL_COLOR_ATTACHMENT4_EXT          0x8CE4
#define GL_COLOR_ATTACHMENT5_EXT          0x8CE5
#define GL_COLOR_ATTACHMENT6_EXT          0x8CE6
#define GL_COLOR_ATTACHMENT7_EXT          0x8CE7
#define GL_COLOR_ATTACHMENT8_EXT          0x8CE8
#define GL_COLOR_ATTACHMENT9_EXT          0x8CE9
#define GL_COLOR_ATTACHMENT10_EXT         0x8CEA
#define GL_COLOR_ATTACHMENT11_EXT         0x8CEB
#define GL_COLOR_ATTACHMENT12_EXT         0x8CEC
#define GL_COLOR_ATTACHMENT13_EXT         0x8CED
#define GL_COLOR_ATTACHMENT14_EXT         0x8CEE
#define GL_COLOR_ATTACHMENT15_EXT         0x8CEF
#define GL_DEPTH_ATTACHMENT_EXT           0x8D00
#define GL_STENCIL_ATTACHMENT_EXT         0x8D20
#define GL_FRAMEBUFFER_EXT                0x8D40
#define GL_RENDERBUFFER_EXT               0x8D41
#define GL_RENDERBUFFER_WIDTH_EXT         0x8D42
#define GL_RENDERBUFFER_HEIGHT_EXT        0x8D43
#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44
#define GL_STENCIL_INDEX1_EXT             0x8D46
#define GL_STENCIL_INDEX4_EXT             0x8D47
#define GL_STENCIL_INDEX8_EXT             0x8D48
#define GL_STENCIL_INDEX16_EXT            0x8D49
#define GL_RENDERBUFFER_RED_SIZE_EXT      0x8D50
#define GL_RENDERBUFFER_GREEN_SIZE_EXT    0x8D51
#define GL_RENDERBUFFER_BLUE_SIZE_EXT     0x8D52
#define GL_RENDERBUFFER_ALPHA_SIZE_EXT    0x8D53
#define GL_RENDERBUFFER_DEPTH_SIZE_EXT    0x8D54
#define GL_RENDERBUFFER_STENCIL_SIZE_EXT  0x8D55
#endif

#ifndef GL_GREMEDY_string_marker
#endif


/*************************************************************/

#include <stddef.h>
#ifndef GL_VERSION_2_0
/* GL type for program/shader text */
typedef char GLchar;			/* native character */
#endif

#ifndef GL_VERSION_1_5
/* GL types for handling large vertex buffer objects */
#ifdef __APPLE__
typedef long GLintptr;
typedef long GLsizeiptr;
#else
typedef ptrdiff_t GLintptr;
typedef ptrdiff_t GLsizeiptr;
#endif
#endif

#ifndef GL_ARB_vertex_buffer_object
/* GL types for handling large vertex buffer objects */
#ifdef __APPLE__
typedef long GLintptrARB;
typedef long GLsizeiptrARB;
#else
typedef ptrdiff_t GLintptrARB;
typedef ptrdiff_t GLsizeiptrARB;
#endif
#endif

#ifndef GL_ARB_shader_objects
/* GL types for handling shader object handles and program/shader text */
typedef char GLcharARB;		/* native character */
#if defined(__APPLE__)
typedef void *GLhandleARB;	/* shader object handle */
#else
typedef unsigned int GLhandleARB;	/* shader object handle */
#endif
#endif

/* GL types for "half" precision (s10e5) float data in host memory */
#ifndef GL_ARB_half_float_pixel
typedef unsigned short GLhalfARB;
#endif

#ifndef GL_NV_half_float
typedef unsigned short GLhalfNV;
#endif

#ifndef GL_VERSION_1_2
#define GL_VERSION_1_2 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf);
GLAPI void APIENTRY glBlendEquation (GLenum);
GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei);
GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei);
GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat);
GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint);
GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei);
GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean);
GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean);
GLAPI void APIENTRY glResetHistogram (GLenum);
GLAPI void APIENTRY glResetMinmax (GLenum);
GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode);
typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink);
typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target);
typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target);
typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
#endif

#ifndef GL_VERSION_1_3
#define GL_VERSION_1_3 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glActiveTexture (GLenum);
GLAPI void APIENTRY glClientActiveTexture (GLenum);
GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble);
GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat);
GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint);
GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort);
GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *);
GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble);
GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat);
GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint);
GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort);
GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *);
GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint);
GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *);
GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *);
GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *);
GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *);
GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *);
GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *);
GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean);
GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture);
typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m);
typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m);
typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m);
typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m);
typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img);
#endif

#ifndef GL_VERSION_1_4
#define GL_VERSION_1_4 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum);
GLAPI void APIENTRY glFogCoordf (GLfloat);
GLAPI void APIENTRY glFogCoordfv (const GLfloat *);
GLAPI void APIENTRY glFogCoordd (GLdouble);
GLAPI void APIENTRY glFogCoorddv (const GLdouble *);
GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei);
GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat);
GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *);
GLAPI void APIENTRY glPointParameteri (GLenum, GLint);
GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *);
GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte);
GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *);
GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *);
GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *);
GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint);
GLAPI void APIENTRY glSecondaryColor3iv (const GLint *);
GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort);
GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *);
GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte);
GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *);
GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint);
GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *);
GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort);
GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *);
GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble);
GLAPI void APIENTRY glWindowPos2dv (const GLdouble *);
GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat);
GLAPI void APIENTRY glWindowPos2fv (const GLfloat *);
GLAPI void APIENTRY glWindowPos2i (GLint, GLint);
GLAPI void APIENTRY glWindowPos2iv (const GLint *);
GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort);
GLAPI void APIENTRY glWindowPos2sv (const GLshort *);
GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glWindowPos3dv (const GLdouble *);
GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glWindowPos3fv (const GLfloat *);
GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint);
GLAPI void APIENTRY glWindowPos3iv (const GLint *);
GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort);
GLAPI void APIENTRY glWindowPos3sv (const GLshort *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord);
typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord);
typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord);
typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord);
typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y);
typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y);
typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y);
typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z);
typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z);
typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z);
typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v);
#endif

#ifndef GL_VERSION_1_5
#define GL_VERSION_1_5 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *);
GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *);
GLAPI GLboolean APIENTRY glIsQuery (GLuint);
GLAPI void APIENTRY glBeginQuery (GLenum, GLuint);
GLAPI void APIENTRY glEndQuery (GLenum);
GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *);
GLAPI void APIENTRY glBindBuffer (GLenum, GLuint);
GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *);
GLAPI GLboolean APIENTRY glIsBuffer (GLuint);
GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum);
GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *);
GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *);
GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum);
GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum);
GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids);
typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids);
typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id);
typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id);
typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target);
typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params);
typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer);
typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers);
typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers);
typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer);
typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage);
typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data);
typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data);
typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access);
typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target);
typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params);
#endif

#ifndef GL_VERSION_2_0
#define GL_VERSION_2_0 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum);
GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *);
GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum);
GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint);
GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint);
GLAPI void APIENTRY glAttachShader (GLuint, GLuint);
GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *);
GLAPI void APIENTRY glCompileShader (GLuint);
GLAPI GLuint APIENTRY glCreateProgram (void);
GLAPI GLuint APIENTRY glCreateShader (GLenum);
GLAPI void APIENTRY glDeleteProgram (GLuint);
GLAPI void APIENTRY glDeleteShader (GLuint);
GLAPI void APIENTRY glDetachShader (GLuint, GLuint);
GLAPI void APIENTRY glDisableVertexAttribArray (GLuint);
GLAPI void APIENTRY glEnableVertexAttribArray (GLuint);
GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *);
GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *);
GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *);
GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *);
GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *);
GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *);
GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *);
GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *);
GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *);
GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *);
GLAPI GLboolean APIENTRY glIsProgram (GLuint);
GLAPI GLboolean APIENTRY glIsShader (GLuint);
GLAPI void APIENTRY glLinkProgram (GLuint);
GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *);
GLAPI void APIENTRY glUseProgram (GLuint);
GLAPI void APIENTRY glUniform1f (GLint, GLfloat);
GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat);
GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glUniform1i (GLint, GLint);
GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint);
GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *);
GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *);
GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *);
GLAPI void APIENTRY glValidateProgram (GLuint);
GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble);
GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat);
GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort);
GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *);
GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *);
GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *);
GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *);
GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *);
GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *);
GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *);
GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *);
GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *);
GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *);
GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha);
typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs);
typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask);
typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader);
typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name);
typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader);
typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void);
typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type);
typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program);
typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader);
typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader);
typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index);
typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index);
typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name);
typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj);
typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name);
typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog);
typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source);
typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name);
typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params);
typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program);
typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader);
typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program);
typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length);
typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program);
typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0);
typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1);
typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0);
typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1);
typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2);
typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
#endif

#ifndef GL_ARB_multitexture
#define GL_ARB_multitexture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glActiveTextureARB (GLenum);
GLAPI void APIENTRY glClientActiveTextureARB (GLenum);
GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble);
GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat);
GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint);
GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort);
GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *);
GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble);
GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat);
GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint);
GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort);
GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *);
GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint);
GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *);
GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *);
GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *);
GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *);
GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture);
typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v);
#endif

#ifndef GL_ARB_transpose_matrix
#define GL_ARB_transpose_matrix 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *);
GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *);
GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *);
GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m);
typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m);
typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m);
typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m);
#endif

#ifndef GL_ARB_multisample
#define GL_ARB_multisample 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert);
#endif

#ifndef GL_ARB_texture_env_add
#define GL_ARB_texture_env_add 1
#endif

#ifndef GL_ARB_texture_cube_map
#define GL_ARB_texture_cube_map 1
#endif

#ifndef GL_ARB_texture_compression
#define GL_ARB_texture_compression 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data);
typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img);
#endif

#ifndef GL_ARB_texture_border_clamp
#define GL_ARB_texture_border_clamp 1
#endif

#ifndef GL_ARB_point_parameters
#define GL_ARB_point_parameters 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat);
GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params);
#endif

#ifndef GL_ARB_vertex_blend
#define GL_ARB_vertex_blend 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *);
GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *);
GLAPI void APIENTRY glWeightivARB (GLint, const GLint *);
GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *);
GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *);
GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *);
GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *);
GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *);
GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glVertexBlendARB (GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights);
typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights);
typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights);
typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights);
typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights);
typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights);
typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights);
typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights);
typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count);
#endif

#ifndef GL_ARB_matrix_palette
#define GL_ARB_matrix_palette 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint);
GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *);
GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *);
GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *);
GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index);
typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices);
typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices);
typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices);
typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
#endif

#ifndef GL_ARB_texture_env_combine
#define GL_ARB_texture_env_combine 1
#endif

#ifndef GL_ARB_texture_env_crossbar
#define GL_ARB_texture_env_crossbar 1
#endif

#ifndef GL_ARB_texture_env_dot3
#define GL_ARB_texture_env_dot3 1
#endif

#ifndef GL_ARB_texture_mirrored_repeat
#define GL_ARB_texture_mirrored_repeat 1
#endif

#ifndef GL_ARB_depth_texture
#define GL_ARB_depth_texture 1
#endif

#ifndef GL_ARB_shadow
#define GL_ARB_shadow 1
#endif

#ifndef GL_ARB_shadow_ambient
#define GL_ARB_shadow_ambient 1
#endif

#ifndef GL_ARB_window_pos
#define GL_ARB_window_pos 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble);
GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *);
GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat);
GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *);
GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint);
GLAPI void APIENTRY glWindowPos2ivARB (const GLint *);
GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort);
GLAPI void APIENTRY glWindowPos2svARB (const GLshort *);
GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *);
GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *);
GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint);
GLAPI void APIENTRY glWindowPos3ivARB (const GLint *);
GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort);
GLAPI void APIENTRY glWindowPos3svARB (const GLshort *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y);
typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y);
typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y);
typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z);
typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z);
typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z);
typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v);
#endif

#ifndef GL_ARB_vertex_program
#define GL_ARB_vertex_program 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble);
GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat);
GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort);
GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *);
GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *);
GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *);
GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *);
GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *);
GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *);
GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *);
GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *);
GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *);
GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *);
GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *);
GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint);
GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint);
GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint);
GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *);
GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *);
GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *);
GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *);
GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *);
GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *);
GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *);
GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *);
GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *);
GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *);
GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *);
GLAPI GLboolean APIENTRY glIsProgramARB (GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index);
typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string);
typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program);
typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs);
typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs);
typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params);
typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params);
typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params);
typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params);
typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program);
#endif

#ifndef GL_ARB_fragment_program
#define GL_ARB_fragment_program 1
/* All ARB_fragment_program entry points are shared with ARB_vertex_program. */
#endif

#ifndef GL_ARB_vertex_buffer_object
#define GL_ARB_vertex_buffer_object 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint);
GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *);
GLAPI GLboolean APIENTRY glIsBufferARB (GLuint);
GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum);
GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *);
GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *);
GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum);
GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum);
GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer);
typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers);
typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers);
typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer);
typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage);
typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data);
typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data);
typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access);
typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target);
typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params);
#endif

#ifndef GL_ARB_occlusion_query
#define GL_ARB_occlusion_query 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *);
GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *);
GLAPI GLboolean APIENTRY glIsQueryARB (GLuint);
GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint);
GLAPI void APIENTRY glEndQueryARB (GLenum);
GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids);
typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids);
typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id);
typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id);
typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target);
typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params);
#endif

#ifndef GL_ARB_shader_objects
#define GL_ARB_shader_objects 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB);
GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum);
GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB);
GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum);
GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *);
GLAPI void APIENTRY glCompileShaderARB (GLhandleARB);
GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void);
GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB);
GLAPI void APIENTRY glLinkProgramARB (GLhandleARB);
GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB);
GLAPI void APIENTRY glValidateProgramARB (GLhandleARB);
GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat);
GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat);
GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glUniform1iARB (GLint, GLint);
GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint);
GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *);
GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *);
GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *);
GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *);
GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *);
GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *);
GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *);
GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *);
GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj);
typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname);
typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj);
typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType);
typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length);
typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj);
typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void);
typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj);
typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj);
typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj);
typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj);
typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0);
typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1);
typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2);
typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3);
typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0);
typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1);
typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2);
typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3);
typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value);
typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value);
typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog);
typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj);
typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params);
typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params);
typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source);
#endif

#ifndef GL_ARB_vertex_shader
#define GL_ARB_vertex_shader 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *);
GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *);
GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name);
typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name);
typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name);
#endif

#ifndef GL_ARB_fragment_shader
#define GL_ARB_fragment_shader 1
#endif

#ifndef GL_ARB_shading_language_100
#define GL_ARB_shading_language_100 1
#endif

#ifndef GL_ARB_texture_non_power_of_two
#define GL_ARB_texture_non_power_of_two 1
#endif

#ifndef GL_ARB_point_sprite
#define GL_ARB_point_sprite 1
#endif

#ifndef GL_ARB_fragment_program_shadow
#define GL_ARB_fragment_program_shadow 1
#endif

#ifndef GL_ARB_draw_buffers
#define GL_ARB_draw_buffers 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs);
#endif

#ifndef GL_ARB_texture_rectangle
#define GL_ARB_texture_rectangle 1
#endif

#ifndef GL_ARB_color_buffer_float
#define GL_ARB_color_buffer_float 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glClampColorARB (GLenum, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp);
#endif

#ifndef GL_ARB_half_float_pixel
#define GL_ARB_half_float_pixel 1
#endif

#ifndef GL_ARB_texture_float
#define GL_ARB_texture_float 1
#endif

#ifndef GL_ARB_pixel_buffer_object
#define GL_ARB_pixel_buffer_object 1
#endif

#ifndef GL_EXT_abgr
#define GL_EXT_abgr 1
#endif

#ifndef GL_EXT_blend_color
#define GL_EXT_blend_color 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
#endif

#ifndef GL_EXT_polygon_offset
#define GL_EXT_polygon_offset 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias);
#endif

#ifndef GL_EXT_texture
#define GL_EXT_texture 1
#endif

#ifndef GL_EXT_texture3D
#define GL_EXT_texture3D 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels);
#endif

#ifndef GL_SGIS_texture_filter4
#define GL_SGIS_texture_filter4 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights);
typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights);
#endif

#ifndef GL_EXT_subtexture
#define GL_EXT_subtexture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels);
typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels);
#endif

#ifndef GL_EXT_copy_texture
#define GL_EXT_copy_texture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint);
GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint);
GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei);
GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border);
typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border);
typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
#endif

#ifndef GL_EXT_histogram
#define GL_EXT_histogram 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean);
GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean);
GLAPI void APIENTRY glResetHistogramEXT (GLenum);
GLAPI void APIENTRY glResetMinmaxEXT (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values);
typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink);
typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target);
typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target);
#endif

#ifndef GL_EXT_convolution
#define GL_EXT_convolution 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat);
GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint);
GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei);
GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *);
GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image);
typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params);
typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span);
typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column);
#endif

#ifndef GL_EXT_color_matrix
#define GL_EXT_color_matrix 1
#endif

#ifndef GL_SGI_color_table
#define GL_SGI_color_table 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei);
GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params);
#endif

#ifndef GL_SGIX_pixel_texture
#define GL_SGIX_pixel_texture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPixelTexGenSGIX (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode);
#endif

#ifndef GL_SGIS_pixel_texture
#define GL_SGIS_pixel_texture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint);
GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *);
GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat);
GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *);
GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *);
GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params);
#endif

#ifndef GL_SGIS_texture4D
#define GL_SGIS_texture4D 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels);
typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels);
#endif

#ifndef GL_SGI_texture_color_table
#define GL_SGI_texture_color_table 1
#endif

#ifndef GL_EXT_cmyka
#define GL_EXT_cmyka 1
#endif

#ifndef GL_EXT_texture_object
#define GL_EXT_texture_object 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *);
GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint);
GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *);
GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint);
GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences);
typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture);
typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures);
typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures);
typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture);
typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities);
#endif

#ifndef GL_SGIS_detail_texture
#define GL_SGIS_detail_texture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
#endif

#ifndef GL_SGIS_sharpen_texture
#define GL_SGIS_sharpen_texture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *);
GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points);
typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points);
#endif

#ifndef GL_EXT_packed_pixels
#define GL_EXT_packed_pixels 1
#endif

#ifndef GL_SGIS_texture_lod
#define GL_SGIS_texture_lod 1
#endif

#ifndef GL_SGIS_multisample
#define GL_SGIS_multisample 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean);
GLAPI void APIENTRY glSamplePatternSGIS (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert);
typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern);
#endif

#ifndef GL_EXT_rescale_normal
#define GL_EXT_rescale_normal 1
#endif

#ifndef GL_EXT_vertex_array
#define GL_EXT_vertex_array 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glArrayElementEXT (GLint);
GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei);
GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *);
GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *);
GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *);
GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i);
typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count);
typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer);
typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params);
typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer);
#endif

#ifndef GL_EXT_misc_attribute
#define GL_EXT_misc_attribute 1
#endif

#ifndef GL_SGIS_generate_mipmap
#define GL_SGIS_generate_mipmap 1
#endif

#ifndef GL_SGIX_clipmap
#define GL_SGIX_clipmap 1
#endif

#ifndef GL_SGIX_shadow
#define GL_SGIX_shadow 1
#endif

#ifndef GL_SGIS_texture_edge_clamp
#define GL_SGIS_texture_edge_clamp 1
#endif

#ifndef GL_SGIS_texture_border_clamp
#define GL_SGIS_texture_border_clamp 1
#endif

#ifndef GL_EXT_blend_minmax
#define GL_EXT_blend_minmax 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendEquationEXT (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode);
#endif

#ifndef GL_EXT_blend_subtract
#define GL_EXT_blend_subtract 1
#endif

#ifndef GL_EXT_blend_logic_op
#define GL_EXT_blend_logic_op 1
#endif

#ifndef GL_SGIX_interlace
#define GL_SGIX_interlace 1
#endif

#ifndef GL_SGIX_pixel_tiles
#define GL_SGIX_pixel_tiles 1
#endif

#ifndef GL_SGIX_texture_select
#define GL_SGIX_texture_select 1
#endif

#ifndef GL_SGIX_sprite
#define GL_SGIX_sprite 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat);
GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *);
GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint);
GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params);
#endif

#ifndef GL_SGIX_texture_multi_buffer
#define GL_SGIX_texture_multi_buffer 1
#endif

#ifndef GL_EXT_point_parameters
#define GL_EXT_point_parameters 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat);
GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params);
#endif

#ifndef GL_SGIS_point_parameters
#define GL_SGIS_point_parameters 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat);
GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params);
#endif

#ifndef GL_SGIX_instruments
#define GL_SGIX_instruments 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLint APIENTRY glGetInstrumentsSGIX (void);
GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *);
GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *);
GLAPI void APIENTRY glReadInstrumentsSGIX (GLint);
GLAPI void APIENTRY glStartInstrumentsSGIX (void);
GLAPI void APIENTRY glStopInstrumentsSGIX (GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void);
typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer);
typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p);
typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker);
typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void);
typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker);
#endif

#ifndef GL_SGIX_texture_scale_bias
#define GL_SGIX_texture_scale_bias 1
#endif

#ifndef GL_SGIX_framezoom
#define GL_SGIX_framezoom 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFrameZoomSGIX (GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor);
#endif

#ifndef GL_SGIX_tag_sample_buffer
#define GL_SGIX_tag_sample_buffer 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTagSampleBufferSGIX (void);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void);
#endif

#ifndef GL_SGIX_polynomial_ffd
#define GL_SGIX_polynomial_ffd 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *);
GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *);
GLAPI void APIENTRY glDeformSGIX (GLbitfield);
GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points);
typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points);
typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask);
typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask);
#endif

#ifndef GL_SGIX_reference_plane
#define GL_SGIX_reference_plane 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation);
#endif

#ifndef GL_SGIX_flush_raster
#define GL_SGIX_flush_raster 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFlushRasterSGIX (void);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void);
#endif

#ifndef GL_SGIX_depth_texture
#define GL_SGIX_depth_texture 1
#endif

#ifndef GL_SGIS_fog_function
#define GL_SGIS_fog_function 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *);
GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points);
typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points);
#endif

#ifndef GL_SGIX_fog_offset
#define GL_SGIX_fog_offset 1
#endif

#ifndef GL_HP_image_transform
#define GL_HP_image_transform 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint);
GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat);
GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params);
#endif

#ifndef GL_HP_convolution_border_modes
#define GL_HP_convolution_border_modes 1
#endif

#ifndef GL_SGIX_texture_add_env
#define GL_SGIX_texture_add_env 1
#endif

#ifndef GL_EXT_color_subtable
#define GL_EXT_color_subtable 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data);
typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
#endif

#ifndef GL_PGI_vertex_hints
#define GL_PGI_vertex_hints 1
#endif

#ifndef GL_PGI_misc_hints
#define GL_PGI_misc_hints 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glHintPGI (GLenum, GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode);
#endif

#ifndef GL_EXT_paletted_texture
#define GL_EXT_paletted_texture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *);
GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *);
GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table);
typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params);
#endif

#ifndef GL_EXT_clip_volume_hint
#define GL_EXT_clip_volume_hint 1
#endif

#ifndef GL_SGIX_list_priority
#define GL_SGIX_list_priority 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat);
GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *);
GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint);
GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params);
#endif

#ifndef GL_SGIX_ir_instrument1
#define GL_SGIX_ir_instrument1 1
#endif

#ifndef GL_SGIX_calligraphic_fragment
#define GL_SGIX_calligraphic_fragment 1
#endif

#ifndef GL_SGIX_texture_lod_bias
#define GL_SGIX_texture_lod_bias 1
#endif

#ifndef GL_SGIX_shadow_ambient
#define GL_SGIX_shadow_ambient 1
#endif

#ifndef GL_EXT_index_texture
#define GL_EXT_index_texture 1
#endif

#ifndef GL_EXT_index_material
#define GL_EXT_index_material 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode);
#endif

#ifndef GL_EXT_index_func
#define GL_EXT_index_func 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref);
#endif

#ifndef GL_EXT_index_array_formats
#define GL_EXT_index_array_formats 1
#endif

#ifndef GL_EXT_compiled_vertex_array
#define GL_EXT_compiled_vertex_array 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei);
GLAPI void APIENTRY glUnlockArraysEXT (void);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count);
typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void);
#endif

#ifndef GL_EXT_cull_vertex
#define GL_EXT_cull_vertex 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *);
GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params);
typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params);
#endif

#ifndef GL_SGIX_ycrcb
#define GL_SGIX_ycrcb 1
#endif

#ifndef GL_SGIX_fragment_lighting
#define GL_SGIX_fragment_lighting 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum);
GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat);
GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint);
GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat);
GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *);
GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint);
GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *);
GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat);
GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint);
GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param);
#endif

#ifndef GL_IBM_rasterpos_clip
#define GL_IBM_rasterpos_clip 1
#endif

#ifndef GL_HP_texture_lighting
#define GL_HP_texture_lighting 1
#endif

#ifndef GL_EXT_draw_range_elements
#define GL_EXT_draw_range_elements 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices);
#endif

#ifndef GL_WIN_phong_shading
#define GL_WIN_phong_shading 1
#endif

#ifndef GL_WIN_specular_fog
#define GL_WIN_specular_fog 1
#endif

#ifndef GL_EXT_light_texture
#define GL_EXT_light_texture 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glApplyTextureEXT (GLenum);
GLAPI void APIENTRY glTextureLightEXT (GLenum);
GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode);
typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname);
typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode);
#endif

#ifndef GL_SGIX_blend_alpha_minmax
#define GL_SGIX_blend_alpha_minmax 1
#endif

#ifndef GL_EXT_bgra
#define GL_EXT_bgra 1
#endif

#ifndef GL_SGIX_async
#define GL_SGIX_async 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint);
GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *);
GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *);
GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei);
GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei);
GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker);
typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp);
typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp);
typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range);
typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range);
typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker);
#endif

#ifndef GL_SGIX_async_pixel
#define GL_SGIX_async_pixel 1
#endif

#ifndef GL_SGIX_async_histogram
#define GL_SGIX_async_histogram 1
#endif

#ifndef GL_INTEL_parallel_arrays
#define GL_INTEL_parallel_arrays 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *);
GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *);
GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *);
GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer);
typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer);
#endif

#ifndef GL_HP_occlusion_test
#define GL_HP_occlusion_test 1
#endif

#ifndef GL_EXT_pixel_transform
#define GL_EXT_pixel_transform 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint);
GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat);
GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params);
#endif

#ifndef GL_EXT_pixel_transform_color_table
#define GL_EXT_pixel_transform_color_table 1
#endif

#ifndef GL_EXT_shared_texture_palette
#define GL_EXT_shared_texture_palette 1
#endif

#ifndef GL_EXT_separate_specular_color
#define GL_EXT_separate_specular_color 1
#endif

#ifndef GL_EXT_secondary_color
#define GL_EXT_secondary_color 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte);
GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *);
GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *);
GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *);
GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint);
GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *);
GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort);
GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *);
GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte);
GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *);
GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint);
GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *);
GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort);
GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *);
GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v);
typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer);
#endif

#ifndef GL_EXT_texture_perturb_normal
#define GL_EXT_texture_perturb_normal 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTextureNormalEXT (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode);
#endif

#ifndef GL_EXT_multi_draw_arrays
#define GL_EXT_multi_draw_arrays 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei);
GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount);
typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount);
#endif

#ifndef GL_EXT_fog_coord
#define GL_EXT_fog_coord 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFogCoordfEXT (GLfloat);
GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *);
GLAPI void APIENTRY glFogCoorddEXT (GLdouble);
GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *);
GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord);
typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord);
typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord);
typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord);
typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
#endif

#ifndef GL_REND_screen_coordinates
#define GL_REND_screen_coordinates 1
#endif

#ifndef GL_EXT_coordinate_frame
#define GL_EXT_coordinate_frame 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte);
GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *);
GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *);
GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *);
GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint);
GLAPI void APIENTRY glTangent3ivEXT (const GLint *);
GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort);
GLAPI void APIENTRY glTangent3svEXT (const GLshort *);
GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte);
GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *);
GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *);
GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *);
GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint);
GLAPI void APIENTRY glBinormal3ivEXT (const GLint *);
GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort);
GLAPI void APIENTRY glBinormal3svEXT (const GLshort *);
GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz);
typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v);
typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz);
typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz);
typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz);
typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz);
typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz);
typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v);
typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz);
typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz);
typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz);
typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz);
typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer);
#endif

#ifndef GL_EXT_texture_env_combine
#define GL_EXT_texture_env_combine 1
#endif

#ifndef GL_APPLE_specular_vector
#define GL_APPLE_specular_vector 1
#endif

#ifndef GL_APPLE_transform_hint
#define GL_APPLE_transform_hint 1
#endif

#ifndef GL_SGIX_fog_scale
#define GL_SGIX_fog_scale 1
#endif

#ifndef GL_SUNX_constant_data
#define GL_SUNX_constant_data 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFinishTextureSUNX (void);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void);
#endif

#ifndef GL_SUN_global_alpha
#define GL_SUN_global_alpha 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte);
GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort);
GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint);
GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat);
GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble);
GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte);
GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort);
GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor);
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor);
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor);
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor);
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor);
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor);
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor);
typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor);
#endif

#ifndef GL_SUN_triangle_list
#define GL_SUN_triangle_list 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint);
GLAPI void APIENTRY glReplacementCodeusSUN (GLushort);
GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte);
GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *);
GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *);
GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *);
GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer);
#endif

#ifndef GL_SUN_vertex
#define GL_SUN_vertex 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat);
GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *);
GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *);
GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *);
GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *);
GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v);
typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v);
typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v);
typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v);
typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v);
typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v);
typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v);
#endif

#ifndef GL_EXT_blend_func_separate
#define GL_EXT_blend_func_separate 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
#endif

#ifndef GL_INGR_blend_func_separate
#define GL_INGR_blend_func_separate 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
#endif

#ifndef GL_INGR_color_clamp
#define GL_INGR_color_clamp 1
#endif

#ifndef GL_INGR_interlace_read
#define GL_INGR_interlace_read 1
#endif

#ifndef GL_EXT_stencil_wrap
#define GL_EXT_stencil_wrap 1
#endif

#ifndef GL_EXT_422_pixels
#define GL_EXT_422_pixels 1
#endif

#ifndef GL_NV_texgen_reflection
#define GL_NV_texgen_reflection 1
#endif

#ifndef GL_SUN_convolution_border_modes
#define GL_SUN_convolution_border_modes 1
#endif

#ifndef GL_EXT_texture_env_add
#define GL_EXT_texture_env_add 1
#endif

#ifndef GL_EXT_texture_lod_bias
#define GL_EXT_texture_lod_bias 1
#endif

#ifndef GL_EXT_texture_filter_anisotropic
#define GL_EXT_texture_filter_anisotropic 1
#endif

#ifndef GL_EXT_vertex_weighting
#define GL_EXT_vertex_weighting 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glVertexWeightfEXT (GLfloat);
GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *);
GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight);
typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight);
typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer);
#endif

#ifndef GL_NV_light_max_exponent
#define GL_NV_light_max_exponent 1
#endif

#ifndef GL_NV_vertex_array_range
#define GL_NV_vertex_array_range 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glFlushVertexArrayRangeNV (void);
GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void);
typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer);
#endif

#ifndef GL_NV_register_combiners
#define GL_NV_register_combiners 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *);
GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat);
GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *);
GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint);
GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum);
GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean);
GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum);
GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param);
typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum);
typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params);
#endif

#ifndef GL_NV_fog_distance
#define GL_NV_fog_distance 1
#endif

#ifndef GL_NV_texgen_emboss
#define GL_NV_texgen_emboss 1
#endif

#ifndef GL_NV_blend_square
#define GL_NV_blend_square 1
#endif

#ifndef GL_NV_texture_env_combine4
#define GL_NV_texture_env_combine4 1
#endif

#ifndef GL_MESA_resize_buffers
#define GL_MESA_resize_buffers 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glResizeBuffersMESA (void);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void);
#endif

#ifndef GL_MESA_window_pos
#define GL_MESA_window_pos 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble);
GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *);
GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat);
GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *);
GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint);
GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *);
GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort);
GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *);
GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *);
GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *);
GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint);
GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *);
GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort);
GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *);
GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *);
GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *);
GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *);
GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y);
typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y);
typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y);
typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z);
typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z);
typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z);
typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v);
typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v);
typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v);
typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w);
typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v);
typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w);
typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v);
#endif

#ifndef GL_IBM_cull_vertex
#define GL_IBM_cull_vertex 1
#endif

#ifndef GL_IBM_multimode_draw_arrays
#define GL_IBM_multimode_draw_arrays 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint);
GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride);
typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride);
#endif

#ifndef GL_IBM_vertex_array_lists
#define GL_IBM_vertex_array_lists 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint);
GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint);
GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride);
typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride);
#endif

#ifndef GL_SGIX_subsample
#define GL_SGIX_subsample 1
#endif

#ifndef GL_SGIX_ycrcba
#define GL_SGIX_ycrcba 1
#endif

#ifndef GL_SGIX_ycrcb_subsample
#define GL_SGIX_ycrcb_subsample 1
#endif

#ifndef GL_SGIX_depth_pass_instrument
#define GL_SGIX_depth_pass_instrument 1
#endif

#ifndef GL_3DFX_texture_compression_FXT1
#define GL_3DFX_texture_compression_FXT1 1
#endif

#ifndef GL_3DFX_multisample
#define GL_3DFX_multisample 1
#endif

#ifndef GL_3DFX_tbuffer
#define GL_3DFX_tbuffer 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTbufferMask3DFX (GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask);
#endif

#ifndef GL_EXT_multisample
#define GL_EXT_multisample 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean);
GLAPI void APIENTRY glSamplePatternEXT (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert);
typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern);
#endif

#ifndef GL_SGIX_vertex_preclip
#define GL_SGIX_vertex_preclip 1
#endif

#ifndef GL_SGIX_convolution_accuracy
#define GL_SGIX_convolution_accuracy 1
#endif

#ifndef GL_SGIX_resample
#define GL_SGIX_resample 1
#endif

#ifndef GL_SGIS_point_line_texgen
#define GL_SGIS_point_line_texgen 1
#endif

#ifndef GL_SGIS_texture_color_mask
#define GL_SGIS_texture_color_mask 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha);
#endif

#ifndef GL_SGIX_igloo_interface
#define GL_SGIX_igloo_interface 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params);
#endif

#ifndef GL_EXT_texture_env_dot3
#define GL_EXT_texture_env_dot3 1
#endif

#ifndef GL_ATI_texture_mirror_once
#define GL_ATI_texture_mirror_once 1
#endif

#ifndef GL_NV_fence
#define GL_NV_fence 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *);
GLAPI GLboolean APIENTRY glIsFenceNV (GLuint);
GLAPI GLboolean APIENTRY glTestFenceNV (GLuint);
GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glFinishFenceNV (GLuint);
GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences);
typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences);
typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence);
typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence);
typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence);
typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition);
#endif

#ifndef GL_NV_evaluators
#define GL_NV_evaluators 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *);
GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *);
GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *);
GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points);
typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params);
typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points);
typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode);
#endif

#ifndef GL_NV_packed_depth_stencil
#define GL_NV_packed_depth_stencil 1
#endif

#ifndef GL_NV_register_combiners2
#define GL_NV_register_combiners2 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *);
GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params);
typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params);
#endif

#ifndef GL_NV_texture_compression_vtc
#define GL_NV_texture_compression_vtc 1
#endif

#ifndef GL_NV_texture_rectangle
#define GL_NV_texture_rectangle 1
#endif

#ifndef GL_NV_texture_shader
#define GL_NV_texture_shader 1
#endif

#ifndef GL_NV_texture_shader2
#define GL_NV_texture_shader2 1
#endif

#ifndef GL_NV_vertex_array_range2
#define GL_NV_vertex_array_range2 1
#endif

#ifndef GL_NV_vertex_program
#define GL_NV_vertex_program 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *);
GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint);
GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *);
GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *);
GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *);
GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *);
GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *);
GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *);
GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *);
GLAPI GLboolean APIENTRY glIsProgramNV (GLuint);
GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *);
GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *);
GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *);
GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *);
GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *);
GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *);
GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum);
GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *);
GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble);
GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat);
GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort);
GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *);
GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *);
GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *);
GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte);
GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *);
GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *);
GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *);
GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *);
GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *);
GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *);
GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *);
GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *);
GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *);
GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *);
GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences);
typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id);
typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params);
typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs);
typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params);
typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program);
typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer);
typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id);
typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v);
typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v);
typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs);
typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform);
typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v);
#endif

#ifndef GL_SGIX_texture_coordinate_clamp
#define GL_SGIX_texture_coordinate_clamp 1
#endif

#ifndef GL_SGIX_scalebias_hint
#define GL_SGIX_scalebias_hint 1
#endif

#ifndef GL_OML_interlace
#define GL_OML_interlace 1
#endif

#ifndef GL_OML_subsample
#define GL_OML_subsample 1
#endif

#ifndef GL_OML_resample
#define GL_OML_resample 1
#endif

#ifndef GL_NV_copy_depth_to_color
#define GL_NV_copy_depth_to_color 1
#endif

#ifndef GL_ATI_envmap_bumpmap
#define GL_ATI_envmap_bumpmap 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *);
GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *);
GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *);
GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param);
typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param);
typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param);
typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param);
#endif

#ifndef GL_ATI_fragment_shader
#define GL_ATI_fragment_shader 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint);
GLAPI void APIENTRY glBindFragmentShaderATI (GLuint);
GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint);
GLAPI void APIENTRY glBeginFragmentShaderATI (void);
GLAPI void APIENTRY glEndFragmentShaderATI (void);
GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum);
GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum);
GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range);
typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id);
typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id);
typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void);
typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void);
typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle);
typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle);
typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod);
typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod);
typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod);
typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value);
#endif

#ifndef GL_ATI_pn_triangles
#define GL_ATI_pn_triangles 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint);
GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param);
#endif

#ifndef GL_ATI_vertex_array_object
#define GL_ATI_vertex_array_object 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum);
GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint);
GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum);
GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glFreeObjectBufferATI (GLuint);
GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint);
GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *);
GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *);
GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint);
GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage);
typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer);
typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve);
typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer);
typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset);
typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params);
#endif

#ifndef GL_EXT_vertex_shader
#define GL_EXT_vertex_shader 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBeginVertexShaderEXT (void);
GLAPI void APIENTRY glEndVertexShaderEXT (void);
GLAPI void APIENTRY glBindVertexShaderEXT (GLuint);
GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint);
GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint);
GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint);
GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint);
GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum);
GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint);
GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint);
GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint);
GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *);
GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *);
GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *);
GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *);
GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *);
GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *);
GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *);
GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *);
GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *);
GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *);
GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *);
GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint);
GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint);
GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum);
GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum);
GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum);
GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum);
GLAPI GLuint APIENTRY glBindParameterEXT (GLenum);
GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum);
GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *);
GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *);
GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *);
GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *);
GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void);
typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void);
typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id);
typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range);
typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id);
typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1);
typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2);
typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3);
typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW);
typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num);
typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components);
typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr);
typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr);
typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr);
typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr);
typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr);
typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr);
typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr);
typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr);
typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr);
typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr);
typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id);
typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value);
typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value);
typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value);
typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value);
typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value);
typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap);
typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data);
typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data);
typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data);
typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data);
#endif

#ifndef GL_ATI_vertex_streams
#define GL_ATI_vertex_streams 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort);
GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *);
GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint);
GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *);
GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat);
GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *);
GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble);
GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *);
GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort);
GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *);
GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint);
GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *);
GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *);
GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *);
GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *);
GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint);
GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *);
GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *);
GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *);
GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *);
GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint);
GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *);
GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *);
GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *);
GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte);
GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *);
GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort);
GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *);
GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint);
GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *);
GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *);
GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *);
GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum);
GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint);
GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x);
typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x);
typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x);
typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x);
typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y);
typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z);
typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords);
typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz);
typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords);
typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz);
typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords);
typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz);
typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords);
typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz);
typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords);
typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz);
typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords);
typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream);
typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param);
#endif

#ifndef GL_ATI_element_array
#define GL_ATI_element_array 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *);
GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei);
GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count);
typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count);
#endif

#ifndef GL_SUN_mesh_array
#define GL_SUN_mesh_array 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width);
#endif

#ifndef GL_SUN_slice_accum
#define GL_SUN_slice_accum 1
#endif

#ifndef GL_NV_multisample_filter_hint
#define GL_NV_multisample_filter_hint 1
#endif

#ifndef GL_NV_depth_clamp
#define GL_NV_depth_clamp 1
#endif

#ifndef GL_NV_occlusion_query
#define GL_NV_occlusion_query 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *);
GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *);
GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint);
GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint);
GLAPI void APIENTRY glEndOcclusionQueryNV (void);
GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *);
GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids);
typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids);
typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id);
typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id);
typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void);
typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params);
#endif

#ifndef GL_NV_point_sprite
#define GL_NV_point_sprite 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint);
GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param);
typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params);
#endif

#ifndef GL_NV_texture_shader3
#define GL_NV_texture_shader3 1
#endif

#ifndef GL_NV_vertex_program1_1
#define GL_NV_vertex_program1_1 1
#endif

#ifndef GL_EXT_shadow_funcs
#define GL_EXT_shadow_funcs 1
#endif

#ifndef GL_EXT_stencil_two_side
#define GL_EXT_stencil_two_side 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face);
#endif

#ifndef GL_ATI_text_fragment_shader
#define GL_ATI_text_fragment_shader 1
#endif

#ifndef GL_APPLE_client_storage
#define GL_APPLE_client_storage 1
#endif

#ifndef GL_APPLE_element_array
#define GL_APPLE_element_array 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *);
GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei);
GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei);
GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei);
GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer);
typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count);
typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount);
typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount);
#endif

#ifndef GL_APPLE_fence
#define GL_APPLE_fence 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *);
GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *);
GLAPI void APIENTRY glSetFenceAPPLE (GLuint);
GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint);
GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint);
GLAPI void APIENTRY glFinishFenceAPPLE (GLuint);
GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint);
GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences);
typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences);
typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence);
typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence);
typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence);
typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence);
typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name);
typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name);
#endif

#ifndef GL_APPLE_vertex_array_object
#define GL_APPLE_vertex_array_object 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint);
GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, const GLuint *);
GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array);
typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays);
typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays);
typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array);
#endif

#ifndef GL_APPLE_vertex_array_range
#define GL_APPLE_vertex_array_range 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *);
GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *);
GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer);
typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param);
#endif

#ifndef GL_APPLE_ycbcr_422
#define GL_APPLE_ycbcr_422 1
#endif

#ifndef GL_S3_s3tc
#define GL_S3_s3tc 1
#endif

#ifndef GL_ATI_draw_buffers
#define GL_ATI_draw_buffers 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs);
#endif

#ifndef GL_ATI_pixel_format_float
#define GL_ATI_pixel_format_float 1
/* This is really a WGL extension, but defines some associated GL enums.
 * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string.
 */
#endif

#ifndef GL_ATI_texture_env_combine3
#define GL_ATI_texture_env_combine3 1
#endif

#ifndef GL_ATI_texture_float
#define GL_ATI_texture_float 1
#endif

#ifndef GL_NV_float_buffer
#define GL_NV_float_buffer 1
#endif

#ifndef GL_NV_fragment_program
#define GL_NV_fragment_program 1
/* Some NV_fragment_program entry points are shared with ARB_vertex_program. */
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat);
GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble);
GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *);
GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *);
GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *);
GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v);
typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v);
typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params);
typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params);
#endif

#ifndef GL_NV_half_float
#define GL_NV_half_float 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *);
GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *);
GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *);
GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *);
GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *);
GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *);
GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV);
GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *);
GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *);
GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *);
GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *);
GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV);
GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *);
GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *);
GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *);
GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *);
GLAPI void APIENTRY glFogCoordhNV (GLhalfNV);
GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *);
GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *);
GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV);
GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *);
GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV);
GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *);
GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *);
GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *);
GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV);
GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *);
GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *);
GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *);
GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *);
GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y);
typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z);
typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz);
typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha);
typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s);
typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t);
typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r);
typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s);
typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t);
typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r);
typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q);
typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog);
typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue);
typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight);
typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x);
typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y);
typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z);
typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w);
typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v);
#endif

#ifndef GL_NV_pixel_data_range
#define GL_NV_pixel_data_range 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *);
GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer);
typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target);
#endif

#ifndef GL_NV_primitive_restart
#define GL_NV_primitive_restart 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glPrimitiveRestartNV (void);
GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void);
typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index);
#endif

#ifndef GL_NV_texture_expand_normal
#define GL_NV_texture_expand_normal 1
#endif

#ifndef GL_NV_vertex_program2
#define GL_NV_vertex_program2 1
#endif

#ifndef GL_ATI_map_object_buffer
#define GL_ATI_map_object_buffer 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint);
GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer);
typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer);
#endif

#ifndef GL_ATI_separate_stencil
#define GL_ATI_separate_stencil 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum);
GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass);
typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask);
#endif

#ifndef GL_ATI_vertex_attrib_array_object
#define GL_ATI_vertex_attrib_array_object 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint);
GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *);
GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params);
typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params);
#endif

#ifndef GL_OES_read_format
#define GL_OES_read_format 1
#endif

#ifndef GL_EXT_depth_bounds_test
#define GL_EXT_depth_bounds_test 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax);
#endif

#ifndef GL_EXT_texture_mirror_clamp
#define GL_EXT_texture_mirror_clamp 1
#endif

#ifndef GL_EXT_blend_equation_separate
#define GL_EXT_blend_equation_separate 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha);
#endif

#ifndef GL_MESA_pack_invert
#define GL_MESA_pack_invert 1
#endif

#ifndef GL_MESA_ycbcr_texture
#define GL_MESA_ycbcr_texture 1
#endif

#ifndef GL_EXT_pixel_buffer_object
#define GL_EXT_pixel_buffer_object 1
#endif

#ifndef GL_NV_fragment_program_option
#define GL_NV_fragment_program_option 1
#endif

#ifndef GL_NV_fragment_program2
#define GL_NV_fragment_program2 1
#endif

#ifndef GL_NV_vertex_program2_option
#define GL_NV_vertex_program2_option 1
#endif

#ifndef GL_NV_vertex_program3
#define GL_NV_vertex_program3 1
#endif

#ifndef GL_EXT_framebuffer_object
#define GL_EXT_framebuffer_object 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint);
GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint);
GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *);
GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei);
GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *);
GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint);
GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint);
GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *);
GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *);
GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum);
GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint);
GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint);
GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint);
GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *);
GLAPI void APIENTRY glGenerateMipmapEXT (GLenum);
#endif /* GL_GLEXT_PROTOTYPES */
typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer);
typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer);
typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers);
typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers);
typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height);
typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params);
typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer);
typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer);
typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers);
typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers);
typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target);
typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level);
typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset);
typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer);
typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params);
typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target);
#endif

#ifndef GL_GREMEDY_string_marker
#define GL_GREMEDY_string_marker 1
#ifdef GL_GLEXT_PROTOTYPES
GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *);
#endif /* GL_GLEXT_PROTOTYPES */
typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string);
#endif


#ifdef __cplusplus
}
#endif

#endif
#endif /* NO_SDL_GLEXT */
/*@}*/

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_platform.h.





























































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_platform.h
 *  Try to get a standard set of platform defines
 */

#ifndef _SDL_platform_h
#define _SDL_platform_h

#if defined(_AIX)
#undef __AIX__
#define __AIX__		1
#endif
#if defined(__BEOS__)
#undef __BEOS__
#define __BEOS__	1
#endif
#if defined(__HAIKU__)
#undef __HAIKU__
#define __HAIKU__ 1
#endif
#if defined(bsdi) || defined(__bsdi) || defined(__bsdi__)
#undef __BSDI__
#define __BSDI__	1
#endif
#if defined(_arch_dreamcast)
#undef __DREAMCAST__
#define __DREAMCAST__	1
#endif
#if defined(__FreeBSD__) || defined(__FreeBSD_kernel__) || defined(__DragonFly__)
#undef __FREEBSD__
#define __FREEBSD__	1
#endif
#if defined(__HAIKU__)
#undef __HAIKU__
#define __HAIKU__	1
#endif
#if defined(hpux) || defined(__hpux) || defined(__hpux__)
#undef __HPUX__
#define __HPUX__	1
#endif
#if defined(sgi) || defined(__sgi) || defined(__sgi__) || defined(_SGI_SOURCE)
#undef __IRIX__
#define __IRIX__	1
#endif
#if defined(linux) || defined(__linux) || defined(__linux__)
#undef __LINUX__
#define __LINUX__	1
#endif
#if defined(__APPLE__)
#undef __MACOSX__
#define __MACOSX__	1
#elif defined(macintosh)
#undef __MACOS__
#define __MACOS__	1
#endif
#if defined(__NetBSD__)
#undef __NETBSD__
#define __NETBSD__	1
#endif
#if defined(__OpenBSD__)
#undef __OPENBSD__
#define __OPENBSD__	1
#endif
#if defined(__OS2__)
#undef __OS2__
#define __OS2__		1
#endif
#if defined(osf) || defined(__osf) || defined(__osf__) || defined(_OSF_SOURCE)
#undef __OSF__
#define __OSF__		1
#endif
#if defined(__QNXNTO__)
#undef __QNXNTO__
#define __QNXNTO__	1
#endif
#if defined(riscos) || defined(__riscos) || defined(__riscos__)
#undef __RISCOS__
#define __RISCOS__	1
#endif
#if defined(__SVR4)
#undef __SOLARIS__
#define __SOLARIS__	1
#endif
#if defined(WIN32) || defined(_WIN32)
#undef __WIN32__
#define __WIN32__	1
#endif

#endif /* _SDL_platform_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_quit.h.















































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_quit.h
 *  Include file for SDL quit event handling
 */

#ifndef _SDL_quit_h
#define _SDL_quit_h

#include "SDL_stdinc.h"
#include "SDL_error.h"

/** @file SDL_quit.h
 *  An SDL_QUITEVENT is generated when the user tries to close the application
 *  window.  If it is ignored or filtered out, the window will remain open.
 *  If it is not ignored or filtered, it is queued normally and the window
 *  is allowed to close.  When the window is closed, screen updates will 
 *  complete, but have no effect.
 *
 *  SDL_Init() installs signal handlers for SIGINT (keyboard interrupt)
 *  and SIGTERM (system termination request), if handlers do not already
 *  exist, that generate SDL_QUITEVENT events as well.  There is no way
 *  to determine the cause of an SDL_QUITEVENT, but setting a signal
 *  handler in your application will override the default generation of
 *  quit events for that signal.
 */

/** @file SDL_quit.h
 *  There are no functions directly affecting the quit event 
 */

#define SDL_QuitRequested() \
        (SDL_PumpEvents(), SDL_PeepEvents(NULL,0,SDL_PEEKEVENT,SDL_QUITMASK))

#endif /* _SDL_quit_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_rwops.h.























































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_rwops.h
 *  This file provides a general interface for SDL to read and write
 *  data sources.  It can easily be extended to files, memory, etc.
 */

#ifndef _SDL_rwops_h
#define _SDL_rwops_h

#include "SDL_stdinc.h"
#include "SDL_error.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** This is the read/write operation structure -- very basic */

typedef struct SDL_RWops {
	/** Seek to 'offset' relative to whence, one of stdio's whence values:
	 *	SEEK_SET, SEEK_CUR, SEEK_END
	 *  Returns the final offset in the data source.
	 */
	int (SDLCALL *seek)(struct SDL_RWops *context, int offset, int whence);

	/** Read up to 'maxnum' objects each of size 'size' from the data
	 *  source to the area pointed at by 'ptr'.
	 *  Returns the number of objects read, or -1 if the read failed.
	 */
	int (SDLCALL *read)(struct SDL_RWops *context, void *ptr, int size, int maxnum);

	/** Write exactly 'num' objects each of size 'objsize' from the area
	 *  pointed at by 'ptr' to data source.
	 *  Returns 'num', or -1 if the write failed.
	 */
	int (SDLCALL *write)(struct SDL_RWops *context, const void *ptr, int size, int num);

	/** Close and free an allocated SDL_FSops structure */
	int (SDLCALL *close)(struct SDL_RWops *context);

	Uint32 type;
	union {
#if defined(__WIN32__) && !defined(__SYMBIAN32__)
	    struct {
		int   append;
		void *h;
		struct {
		    void *data;
		    int size;
		    int left;
		} buffer;
	    } win32io;
#endif
#ifdef HAVE_STDIO_H 
	    struct {
		int autoclose;
	 	FILE *fp;
	    } stdio;
#endif
	    struct {
		Uint8 *base;
	 	Uint8 *here;
		Uint8 *stop;
	    } mem;
	    struct {
		void *data1;
	    } unknown;
	} hidden;

} SDL_RWops;


/** @name Functions to create SDL_RWops structures from various data sources */
/*@{*/

extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFile(const char *file, const char *mode);

#ifdef HAVE_STDIO_H
extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFP(FILE *fp, int autoclose);
#endif

extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromMem(void *mem, int size);
extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromConstMem(const void *mem, int size);

extern DECLSPEC SDL_RWops * SDLCALL SDL_AllocRW(void);
extern DECLSPEC void SDLCALL SDL_FreeRW(SDL_RWops *area);

/*@}*/

/** @name Seek Reference Points */
/*@{*/
#define RW_SEEK_SET	0	/**< Seek from the beginning of data */
#define RW_SEEK_CUR	1	/**< Seek relative to current read point */
#define RW_SEEK_END	2	/**< Seek relative to the end of data */
/*@}*/

/** @name Macros to easily read and write from an SDL_RWops structure */
/*@{*/
#define SDL_RWseek(ctx, offset, whence)	(ctx)->seek(ctx, offset, whence)
#define SDL_RWtell(ctx)			(ctx)->seek(ctx, 0, RW_SEEK_CUR)
#define SDL_RWread(ctx, ptr, size, n)	(ctx)->read(ctx, ptr, size, n)
#define SDL_RWwrite(ctx, ptr, size, n)	(ctx)->write(ctx, ptr, size, n)
#define SDL_RWclose(ctx)		(ctx)->close(ctx)
/*@}*/

/** @name Read an item of the specified endianness and return in native format */
/*@{*/
extern DECLSPEC Uint16 SDLCALL SDL_ReadLE16(SDL_RWops *src);
extern DECLSPEC Uint16 SDLCALL SDL_ReadBE16(SDL_RWops *src);
extern DECLSPEC Uint32 SDLCALL SDL_ReadLE32(SDL_RWops *src);
extern DECLSPEC Uint32 SDLCALL SDL_ReadBE32(SDL_RWops *src);
extern DECLSPEC Uint64 SDLCALL SDL_ReadLE64(SDL_RWops *src);
extern DECLSPEC Uint64 SDLCALL SDL_ReadBE64(SDL_RWops *src);
/*@}*/

/** @name Write an item of native format to the specified endianness */
/*@{*/
extern DECLSPEC int SDLCALL SDL_WriteLE16(SDL_RWops *dst, Uint16 value);
extern DECLSPEC int SDLCALL SDL_WriteBE16(SDL_RWops *dst, Uint16 value);
extern DECLSPEC int SDLCALL SDL_WriteLE32(SDL_RWops *dst, Uint32 value);
extern DECLSPEC int SDLCALL SDL_WriteBE32(SDL_RWops *dst, Uint32 value);
extern DECLSPEC int SDLCALL SDL_WriteLE64(SDL_RWops *dst, Uint64 value);
extern DECLSPEC int SDLCALL SDL_WriteBE64(SDL_RWops *dst, Uint64 value);
/*@}*/

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_rwops_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_stdinc.h.

























































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
227
228
229
230
231
232
233
234
235
236
237
238
239
240
241
242
243
244
245
246
247
248
249
250
251
252
253
254
255
256
257
258
259
260
261
262
263
264
265
266
267
268
269
270
271
272
273
274
275
276
277
278
279
280
281
282
283
284
285
286
287
288
289
290
291
292
293
294
295
296
297
298
299
300
301
302
303
304
305
306
307
308
309
310
311
312
313
314
315
316
317
318
319
320
321
322
323
324
325
326
327
328
329
330
331
332
333
334
335
336
337
338
339
340
341
342
343
344
345
346
347
348
349
350
351
352
353
354
355
356
357
358
359
360
361
362
363
364
365
366
367
368
369
370
371
372
373
374
375
376
377
378
379
380
381
382
383
384
385
386
387
388
389
390
391
392
393
394
395
396
397
398
399
400
401
402
403
404
405
406
407
408
409
410
411
412
413
414
415
416
417
418
419
420
421
422
423
424
425
426
427
428
429
430
431
432
433
434
435
436
437
438
439
440
441
442
443
444
445
446
447
448
449
450
451
452
453
454
455
456
457
458
459
460
461
462
463
464
465
466
467
468
469
470
471
472
473
474
475
476
477
478
479
480
481
482
483
484
485
486
487
488
489
490
491
492
493
494
495
496
497
498
499
500
501
502
503
504
505
506
507
508
509
510
511
512
513
514
515
516
517
518
519
520
521
522
523
524
525
526
527
528
529
530
531
532
533
534
535
536
537
538
539
540
541
542
543
544
545
546
547
548
549
550
551
552
553
554
555
556
557
558
559
560
561
562
563
564
565
566
567
568
569
570
571
572
573
574
575
576
577
578
579
580
581
582
583
584
585
586
587
588
589
590
591
592
593
594
595
596
597
598
599
600
601
602
603
604
605
606
607
608
609
610
611
612
613
614
615
616
617
618
619
620
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_stdinc.h
 *  This is a general header that includes C language support
 */

#ifndef _SDL_stdinc_h
#define _SDL_stdinc_h

#include "SDL_config.h"


#ifdef HAVE_SYS_TYPES_H
#include <sys/types.h>
#endif
#ifdef HAVE_STDIO_H
#include <stdio.h>
#endif
#if defined(STDC_HEADERS)
# include <stdlib.h>
# include <stddef.h>
# include <stdarg.h>
#else
# if defined(HAVE_STDLIB_H)
#  include <stdlib.h>
# elif defined(HAVE_MALLOC_H)
#  include <malloc.h>
# endif
# if defined(HAVE_STDDEF_H)
#  include <stddef.h>
# endif
# if defined(HAVE_STDARG_H)
#  include <stdarg.h>
# endif
#endif
#ifdef HAVE_STRING_H
# if !defined(STDC_HEADERS) && defined(HAVE_MEMORY_H)
#  include <memory.h>
# endif
# include <string.h>
#endif
#ifdef HAVE_STRINGS_H
# include <strings.h>
#endif
#if defined(HAVE_INTTYPES_H)
# include <inttypes.h>
#elif defined(HAVE_STDINT_H)
# include <stdint.h>
#endif
#ifdef HAVE_CTYPE_H
# include <ctype.h>
#endif
#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H)
# include <iconv.h>
#endif

/** The number of elements in an array */
#define SDL_arraysize(array)	(sizeof(array)/sizeof(array[0]))
#define SDL_TABLESIZE(table)	SDL_arraysize(table)

/* Use proper C++ casts when compiled as C++ to be compatible with the option
 -Wold-style-cast of GCC (and -Werror=old-style-cast in GCC 4.2 and above. */
#ifdef __cplusplus
#define SDL_reinterpret_cast(type, expression) reinterpret_cast<type>(expression)
#define SDL_static_cast(type, expression) static_cast<type>(expression)
#else
#define SDL_reinterpret_cast(type, expression) ((type)(expression))
#define SDL_static_cast(type, expression) ((type)(expression))
#endif

/** @name Basic data types */
/*@{*/
typedef enum {
	SDL_FALSE = 0,
	SDL_TRUE  = 1
} SDL_bool;

typedef int8_t		Sint8;
typedef uint8_t		Uint8;
typedef int16_t		Sint16;
typedef uint16_t	Uint16;
typedef int32_t		Sint32;
typedef uint32_t	Uint32;

#ifdef SDL_HAS_64BIT_TYPE
typedef int64_t		Sint64;
#ifndef SYMBIAN32_GCCE
typedef uint64_t	Uint64;
#endif
#else
/* This is really just a hack to prevent the compiler from complaining */
typedef struct {
	Uint32 hi;
	Uint32 lo;
} Uint64, Sint64;
#endif

/*@}*/

/** @name Make sure the types really have the right sizes */
/*@{*/
#define SDL_COMPILE_TIME_ASSERT(name, x)               \
       typedef int SDL_dummy_ ## name[(x) * 2 - 1]

SDL_COMPILE_TIME_ASSERT(uint8, sizeof(Uint8) == 1);
SDL_COMPILE_TIME_ASSERT(sint8, sizeof(Sint8) == 1);
SDL_COMPILE_TIME_ASSERT(uint16, sizeof(Uint16) == 2);
SDL_COMPILE_TIME_ASSERT(sint16, sizeof(Sint16) == 2);
SDL_COMPILE_TIME_ASSERT(uint32, sizeof(Uint32) == 4);
SDL_COMPILE_TIME_ASSERT(sint32, sizeof(Sint32) == 4);
SDL_COMPILE_TIME_ASSERT(uint64, sizeof(Uint64) == 8);
SDL_COMPILE_TIME_ASSERT(sint64, sizeof(Sint64) == 8);
/*@}*/

/** @name Enum Size Check
 *  Check to make sure enums are the size of ints, for structure packing.
 *  For both Watcom C/C++ and Borland C/C++ the compiler option that makes
 *  enums having the size of an int must be enabled.
 *  This is "-b" for Borland C/C++ and "-ei" for Watcom C/C++ (v11).
 */
/* Enable enums always int in CodeWarrior (for MPW use "-enum int") */
#ifdef __MWERKS__
#pragma enumsalwaysint on
#endif

typedef enum {
	DUMMY_ENUM_VALUE
} SDL_DUMMY_ENUM;

#ifndef __NDS__
SDL_COMPILE_TIME_ASSERT(enum, sizeof(SDL_DUMMY_ENUM) == sizeof(int));
#endif
/*@}*/

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

#ifdef HAVE_MALLOC
#define SDL_malloc	malloc
#else
extern DECLSPEC void * SDLCALL SDL_malloc(size_t size);
#endif

#ifdef HAVE_CALLOC
#define SDL_calloc	calloc
#else
extern DECLSPEC void * SDLCALL SDL_calloc(size_t nmemb, size_t size);
#endif

#ifdef HAVE_REALLOC
#define SDL_realloc	realloc
#else
extern DECLSPEC void * SDLCALL SDL_realloc(void *mem, size_t size);
#endif

#ifdef HAVE_FREE
#define SDL_free	free
#else
extern DECLSPEC void SDLCALL SDL_free(void *mem);
#endif

#if defined(HAVE_ALLOCA) && !defined(alloca)
# if defined(HAVE_ALLOCA_H)
#  include <alloca.h>
# elif defined(__GNUC__)
#  define alloca __builtin_alloca
# elif defined(_MSC_VER)
#  include <malloc.h>
#  define alloca _alloca
# elif defined(__WATCOMC__)
#  include <malloc.h>
# elif defined(__BORLANDC__)
#  include <malloc.h>
# elif defined(__DMC__)
#  include <stdlib.h>
# elif defined(__AIX__)
  #pragma alloca
# elif defined(__MRC__)
   void *alloca (unsigned);
# else
   char *alloca ();
# endif
#endif
#ifdef HAVE_ALLOCA
#define SDL_stack_alloc(type, count)    (type*)alloca(sizeof(type)*(count))
#define SDL_stack_free(data)
#else
#define SDL_stack_alloc(type, count)    (type*)SDL_malloc(sizeof(type)*(count))
#define SDL_stack_free(data)            SDL_free(data)
#endif

#ifdef HAVE_GETENV
#define SDL_getenv	getenv
#else
extern DECLSPEC char * SDLCALL SDL_getenv(const char *name);
#endif

#ifdef HAVE_PUTENV
#define SDL_putenv	putenv
#else
extern DECLSPEC int SDLCALL SDL_putenv(const char *variable);
#endif

#ifdef HAVE_QSORT
#define SDL_qsort	qsort
#else
extern DECLSPEC void SDLCALL SDL_qsort(void *base, size_t nmemb, size_t size,
           int (*compare)(const void *, const void *));
#endif

#ifdef HAVE_ABS
#define SDL_abs		abs
#else
#define SDL_abs(X)	((X) < 0 ? -(X) : (X))
#endif

#define SDL_min(x, y)	(((x) < (y)) ? (x) : (y))
#define SDL_max(x, y)	(((x) > (y)) ? (x) : (y))

#ifdef HAVE_CTYPE_H
#define SDL_isdigit(X)  isdigit(X)
#define SDL_isspace(X)  isspace(X)
#define SDL_toupper(X)  toupper(X)
#define SDL_tolower(X)  tolower(X)
#else
#define SDL_isdigit(X)  (((X) >= '0') && ((X) <= '9'))
#define SDL_isspace(X)  (((X) == ' ') || ((X) == '\t') || ((X) == '\r') || ((X) == '\n'))
#define SDL_toupper(X)  (((X) >= 'a') && ((X) <= 'z') ? ('A'+((X)-'a')) : (X))
#define SDL_tolower(X)  (((X) >= 'A') && ((X) <= 'Z') ? ('a'+((X)-'A')) : (X))
#endif

#ifdef HAVE_MEMSET
#define SDL_memset      memset
#else
extern DECLSPEC void * SDLCALL SDL_memset(void *dst, int c, size_t len);
#endif

#if defined(__GNUC__) && defined(i386)
#define SDL_memset4(dst, val, len)				\
do {								\
	int u0, u1, u2;						\
	__asm__ __volatile__ (					\
		"cld\n\t"					\
		"rep ; stosl\n\t"				\
		: "=&D" (u0), "=&a" (u1), "=&c" (u2)		\
		: "0" (dst), "1" (val), "2" (SDL_static_cast(Uint32, len))	\
		: "memory" );					\
} while(0)
#endif
#ifndef SDL_memset4
#define SDL_memset4(dst, val, len)		\
do {						\
	unsigned _count = (len);		\
	unsigned _n = (_count + 3) / 4;		\
	Uint32 *_p = SDL_static_cast(Uint32 *, dst);	\
	Uint32 _val = (val);			\
	if (len == 0) break;			\
        switch (_count % 4) {			\
        case 0: do {    *_p++ = _val;		\
        case 3:         *_p++ = _val;		\
        case 2:         *_p++ = _val;		\
        case 1:         *_p++ = _val;		\
		} while ( --_n );		\
	}					\
} while(0)
#endif

/* We can count on memcpy existing on Mac OS X and being well-tuned. */
#if defined(__MACH__) && defined(__APPLE__)
#define SDL_memcpy(dst, src, len) memcpy(dst, src, len)
#elif defined(__GNUC__) && defined(i386)
#define SDL_memcpy(dst, src, len)					  \
do {									  \
	int u0, u1, u2;						  	  \
	__asm__ __volatile__ (						  \
		"cld\n\t"						  \
		"rep ; movsl\n\t"					  \
		"testb $2,%b4\n\t"					  \
		"je 1f\n\t"						  \
		"movsw\n"						  \
		"1:\ttestb $1,%b4\n\t"					  \
		"je 2f\n\t"						  \
		"movsb\n"						  \
		"2:"							  \
		: "=&c" (u0), "=&D" (u1), "=&S" (u2)			  \
		: "0" (SDL_static_cast(unsigned, len)/4), "q" (len), "1" (dst),"2" (src) \
		: "memory" );						  \
} while(0)
#endif
#ifndef SDL_memcpy
#ifdef HAVE_MEMCPY
#define SDL_memcpy      memcpy
#elif defined(HAVE_BCOPY)
#define SDL_memcpy(d, s, n)	bcopy((s), (d), (n))
#else
extern DECLSPEC void * SDLCALL SDL_memcpy(void *dst, const void *src, size_t len);
#endif
#endif

/* We can count on memcpy existing on Mac OS X and being well-tuned. */
#if defined(__MACH__) && defined(__APPLE__)
#define SDL_memcpy4(dst, src, len) memcpy(dst, src, (len)*4)
#elif defined(__GNUC__) && defined(i386)
#define SDL_memcpy4(dst, src, len)				\
do {								\
	int ecx, edi, esi;					\
	__asm__ __volatile__ (					\
		"cld\n\t"					\
		"rep ; movsl"					\
		: "=&c" (ecx), "=&D" (edi), "=&S" (esi)		\
		: "0" (SDL_static_cast(unsigned, len)), "1" (dst), "2" (src)	\
		: "memory" );					\
} while(0)
#endif
#ifndef SDL_memcpy4
#define SDL_memcpy4(dst, src, len)	SDL_memcpy(dst, src, (len) << 2)
#endif

#if defined(__GNUC__) && defined(i386)
#define SDL_revcpy(dst, src, len)			\
do {							\
	int u0, u1, u2;					\
	char *dstp = SDL_static_cast(char *, dst);	\
	char *srcp = SDL_static_cast(char *, src);	\
	int n = (len);					\
	if ( n >= 4 ) {					\
	__asm__ __volatile__ (				\
		"std\n\t"				\
		"rep ; movsl\n\t"			\
		"cld\n\t"				\
		: "=&c" (u0), "=&D" (u1), "=&S" (u2)	\
		: "0" (n >> 2),				\
		  "1" (dstp+(n-4)), "2" (srcp+(n-4))	\
		: "memory" );				\
	}						\
	switch (n & 3) {				\
		case 3: dstp[2] = srcp[2];		\
		case 2: dstp[1] = srcp[1];		\
		case 1: dstp[0] = srcp[0];		\
			break;				\
		default:				\
			break;				\
	}						\
} while(0)
#endif
#ifndef SDL_revcpy
extern DECLSPEC void * SDLCALL SDL_revcpy(void *dst, const void *src, size_t len);
#endif

#ifdef HAVE_MEMMOVE
#define SDL_memmove     memmove
#elif defined(HAVE_BCOPY)
#define SDL_memmove(d, s, n)	bcopy((s), (d), (n))
#else
#define SDL_memmove(dst, src, len)			\
do {							\
	if ( dst < src ) {				\
		SDL_memcpy(dst, src, len);		\
	} else {					\
		SDL_revcpy(dst, src, len);		\
	}						\
} while(0)
#endif

#ifdef HAVE_MEMCMP
#define SDL_memcmp      memcmp
#else
extern DECLSPEC int SDLCALL SDL_memcmp(const void *s1, const void *s2, size_t len);
#endif

#ifdef HAVE_STRLEN
#define SDL_strlen      strlen
#else
extern DECLSPEC size_t SDLCALL SDL_strlen(const char *string);
#endif

#ifdef HAVE_STRLCPY
#define SDL_strlcpy     strlcpy
#else
extern DECLSPEC size_t SDLCALL SDL_strlcpy(char *dst, const char *src, size_t maxlen);
#endif

#ifdef HAVE_STRLCAT
#define SDL_strlcat    strlcat
#else
extern DECLSPEC size_t SDLCALL SDL_strlcat(char *dst, const char *src, size_t maxlen);
#endif

#ifdef HAVE_STRDUP
#define SDL_strdup     strdup
#else
extern DECLSPEC char * SDLCALL SDL_strdup(const char *string);
#endif

#ifdef HAVE__STRREV
#define SDL_strrev      _strrev
#else
extern DECLSPEC char * SDLCALL SDL_strrev(char *string);
#endif

#ifdef HAVE__STRUPR
#define SDL_strupr      _strupr
#else
extern DECLSPEC char * SDLCALL SDL_strupr(char *string);
#endif

#ifdef HAVE__STRLWR
#define SDL_strlwr      _strlwr
#else
extern DECLSPEC char * SDLCALL SDL_strlwr(char *string);
#endif

#ifdef HAVE_STRCHR
#define SDL_strchr      strchr
#elif defined(HAVE_INDEX)
#define SDL_strchr      index
#else
extern DECLSPEC char * SDLCALL SDL_strchr(const char *string, int c);
#endif

#ifdef HAVE_STRRCHR
#define SDL_strrchr     strrchr
#elif defined(HAVE_RINDEX)
#define SDL_strrchr     rindex
#else
extern DECLSPEC char * SDLCALL SDL_strrchr(const char *string, int c);
#endif

#ifdef HAVE_STRSTR
#define SDL_strstr      strstr
#else
extern DECLSPEC char * SDLCALL SDL_strstr(const char *haystack, const char *needle);
#endif

#ifdef HAVE_ITOA
#define SDL_itoa        itoa
#else
#define SDL_itoa(value, string, radix)	SDL_ltoa((long)value, string, radix)
#endif

#ifdef HAVE__LTOA
#define SDL_ltoa        _ltoa
#else
extern DECLSPEC char * SDLCALL SDL_ltoa(long value, char *string, int radix);
#endif

#ifdef HAVE__UITOA
#define SDL_uitoa       _uitoa
#else
#define SDL_uitoa(value, string, radix)	SDL_ultoa((long)value, string, radix)
#endif

#ifdef HAVE__ULTOA
#define SDL_ultoa       _ultoa
#else
extern DECLSPEC char * SDLCALL SDL_ultoa(unsigned long value, char *string, int radix);
#endif

#ifdef HAVE_STRTOL
#define SDL_strtol      strtol
#else
extern DECLSPEC long SDLCALL SDL_strtol(const char *string, char **endp, int base);
#endif

#ifdef HAVE_STRTOUL
#define SDL_strtoul      strtoul
#else
extern DECLSPEC unsigned long SDLCALL SDL_strtoul(const char *string, char **endp, int base);
#endif

#ifdef SDL_HAS_64BIT_TYPE

#ifdef HAVE__I64TOA
#define SDL_lltoa       _i64toa
#else
extern DECLSPEC char* SDLCALL SDL_lltoa(Sint64 value, char *string, int radix);
#endif

#ifdef HAVE__UI64TOA
#define SDL_ulltoa      _ui64toa
#else
extern DECLSPEC char* SDLCALL SDL_ulltoa(Uint64 value, char *string, int radix);
#endif

#ifdef HAVE_STRTOLL
#define SDL_strtoll     strtoll
#else
extern DECLSPEC Sint64 SDLCALL SDL_strtoll(const char *string, char **endp, int base);
#endif

#ifdef HAVE_STRTOULL
#define SDL_strtoull     strtoull
#else
extern DECLSPEC Uint64 SDLCALL SDL_strtoull(const char *string, char **endp, int base);
#endif

#endif /* SDL_HAS_64BIT_TYPE */

#ifdef HAVE_STRTOD
#define SDL_strtod      strtod
#else
extern DECLSPEC double SDLCALL SDL_strtod(const char *string, char **endp);
#endif

#ifdef HAVE_ATOI
#define SDL_atoi        atoi
#else
#define SDL_atoi(X)     SDL_strtol(X, NULL, 0)
#endif

#ifdef HAVE_ATOF
#define SDL_atof        atof
#else
#define SDL_atof(X)     SDL_strtod(X, NULL)
#endif

#ifdef HAVE_STRCMP
#define SDL_strcmp      strcmp
#else
extern DECLSPEC int SDLCALL SDL_strcmp(const char *str1, const char *str2);
#endif

#ifdef HAVE_STRNCMP
#define SDL_strncmp     strncmp
#else
extern DECLSPEC int SDLCALL SDL_strncmp(const char *str1, const char *str2, size_t maxlen);
#endif

#ifdef HAVE_STRCASECMP
#define SDL_strcasecmp  strcasecmp
#elif defined(HAVE__STRICMP)
#define SDL_strcasecmp  _stricmp
#else
extern DECLSPEC int SDLCALL SDL_strcasecmp(const char *str1, const char *str2);
#endif

#ifdef HAVE_STRNCASECMP
#define SDL_strncasecmp strncasecmp
#elif defined(HAVE__STRNICMP)
#define SDL_strncasecmp _strnicmp
#else
extern DECLSPEC int SDLCALL SDL_strncasecmp(const char *str1, const char *str2, size_t maxlen);
#endif

#ifdef HAVE_SSCANF
#define SDL_sscanf      sscanf
#else
extern DECLSPEC int SDLCALL SDL_sscanf(const char *text, const char *fmt, ...);
#endif

#ifdef HAVE_SNPRINTF
#define SDL_snprintf    snprintf
#else
extern DECLSPEC int SDLCALL SDL_snprintf(char *text, size_t maxlen, const char *fmt, ...);
#endif

#ifdef HAVE_VSNPRINTF
#define SDL_vsnprintf   vsnprintf
#else
extern DECLSPEC int SDLCALL SDL_vsnprintf(char *text, size_t maxlen, const char *fmt, va_list ap);
#endif

/** @name SDL_ICONV Error Codes
 *  The SDL implementation of iconv() returns these error codes 
 */
/*@{*/
#define SDL_ICONV_ERROR		(size_t)-1
#define SDL_ICONV_E2BIG		(size_t)-2
#define SDL_ICONV_EILSEQ	(size_t)-3
#define SDL_ICONV_EINVAL	(size_t)-4
/*@}*/

#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H)
#define SDL_iconv_t     iconv_t
#define SDL_iconv_open  iconv_open
#define SDL_iconv_close iconv_close
#else
typedef struct _SDL_iconv_t *SDL_iconv_t;
extern DECLSPEC SDL_iconv_t SDLCALL SDL_iconv_open(const char *tocode, const char *fromcode);
extern DECLSPEC int SDLCALL SDL_iconv_close(SDL_iconv_t cd);
#endif
extern DECLSPEC size_t SDLCALL SDL_iconv(SDL_iconv_t cd, const char **inbuf, size_t *inbytesleft, char **outbuf, size_t *outbytesleft);
/** This function converts a string between encodings in one pass, returning a
 *  string that must be freed with SDL_free() or NULL on error.
 */
extern DECLSPEC char * SDLCALL SDL_iconv_string(const char *tocode, const char *fromcode, const char *inbuf, size_t inbytesleft);
#define SDL_iconv_utf8_locale(S)	SDL_iconv_string("", "UTF-8", S, SDL_strlen(S)+1)
#define SDL_iconv_utf8_ucs2(S)		(Uint16 *)SDL_iconv_string("UCS-2", "UTF-8", S, SDL_strlen(S)+1)
#define SDL_iconv_utf8_ucs4(S)		(Uint32 *)SDL_iconv_string("UCS-4", "UTF-8", S, SDL_strlen(S)+1)

/* Ends C function definitions when using C++ */
#ifdef __cplusplus
}
#endif
#include "close_code.h"

#endif /* _SDL_stdinc_h */

Added t2048/vendor/SDL-1.2.15/include/SDL/SDL_syswm.h.





































































































































































































































































































































































































































































>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
>
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
61
62
63
64
65
66
67
68
69
70
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85
86
87
88
89
90
91
92
93
94
95
96
97
98
99
100
101
102
103
104
105
106
107
108
109
110
111
112
113
114
115
116
117
118
119
120
121
122
123
124
125
126
127
128
129
130
131
132
133
134
135
136
137
138
139
140
141
142
143
144
145
146
147
148
149
150
151
152
153
154
155
156
157
158
159
160
161
162
163
164
165
166
167
168
169
170
171
172
173
174
175
176
177
178
179
180
181
182
183
184
185
186
187
188
189
190
191
192
193
194
195
196
197
198
199
200
201
202
203
204
205
206
207
208
209
210
211
212
213
214
215
216
217
218
219
220
221
222
223
224
225
226
/*
    SDL - Simple DirectMedia Layer
    Copyright (C) 1997-2012 Sam Lantinga

    This library is free software; you can redistribute it and/or
    modify it under the terms of the GNU Lesser General Public
    License as published by the Free Software Foundation; either
    version 2.1 of the License, or (at your option) any later version.

    This library is distributed in the hope that it will be useful,
    but WITHOUT ANY WARRANTY; without even the implied warranty of
    MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the GNU
    Lesser General Public License for more details.

    You should have received a copy of the GNU Lesser General Public
    License along with this library; if not, write to the Free Software
    Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA  02110-1301  USA

    Sam Lantinga
    slouken@libsdl.org
*/

/** @file SDL_syswm.h
 *  Include file for SDL custom system window manager hooks
 */

#ifndef _SDL_syswm_h
#define _SDL_syswm_h

#include "SDL_stdinc.h"
#include "SDL_error.h"
#include "SDL_version.h"

#include "begin_code.h"
/* Set up for C function definitions, even when using C++ */
#ifdef __cplusplus
extern "C" {
#endif

/** @file SDL_syswm.h
 *  Your application has access to a special type of event 'SDL_SYSWMEVENT',
 *  which contains window-manager specific information and arrives whenever
 *  an unhandled window event occurs.  This event is ignored by default, but
 *  you can enable it with SDL_EventState()
 */
#ifdef SDL_PROTOTYPES_ONLY
struct SDL_SysWMinfo;
typedef struct SDL_SysWMinfo SDL_SysWMinfo;
#else

/* This is the structure for custom window manager events */
#if defined(SDL_VIDEO_DRIVER_X11)
#if defined(__APPLE__) && defined(__MACH__)
/* conflicts with Quickdraw.h */
#define Cursor X11Cursor
#endif

#include <X11/Xlib.h>
#include <X11/Xatom.h>

#if defined(__APPLE__) && defined(__MACH__)
/* matches the re-define above */
#undef Cursor
#endif

/** These are the various supported subsystems under UNIX */
typedef enum {
	SDL_SYSWM_X11
} SDL_SYSWM_TYPE;

/** The UNIX custom event structure */
struct SDL_SysWMmsg {
	SDL_version version;
	SDL_SYSWM_TYPE subsystem;
	union {
	    XEvent xevent;
	} event;
};

/** The UNIX custom window manager information structure.
 *  When this structure is returned, it holds information about which
 *  low level system it is using, and will be one of SDL_SYSWM_TYPE.
 */
typedef struct SDL_SysWMinfo {
	SDL_version version;
	SDL_SYSWM_TYPE subsystem;
	union {
	    struct {
	    	Display *display;	/**< The X11 display */
	    	Window window;		/**< The X11 display window */
		/** These locking functions should be called around
                 *  any X11 functions using the display variable, 
                 *  but not the gfxdisplay variable.
                 *  They lock the event thread, so should not be
		 *  called around event fu